KEGG   Homo sapiens (human): 1244Help
Entry
1244              CDS       T01001                                 

Gene name
ABCC2, ABC30, CMOAT, DJS, MRP2, cMRP
Definition
(RefSeq) ATP binding cassette subfamily C member 2
  KO
K05666  
ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
hsa  Homo sapiens (human)
Pathway
Antifolate resistance
Platinum drug resistance
ABC transporters
Bile secretion
Disease
H00208  
Hyperbilirubinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    1244 (ABCC2)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    1244 (ABCC2)
 Human Diseases
  Drug resistance
   01524 Platinum drug resistance
    1244 (ABCC2)
   01523 Antifolate resistance
    1244 (ABCC2)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    1244 (ABCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q92887(Tbio)
UniProt: 
Position
10q24.2
AA seq 1545 aa AA seqDB search
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
NT seq 4638 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaagttctgcaactctactttttggaattcctcattcctggacagtccggag
gcagacctgccactttgttttgagcaaactgttctggtgtggattcccttgggcttccta
tggctcctggccccctggcagcttctccacgtgtataaatccaggaccaagagatcctct
accaccaaactctatcttgctaagcaggtattcgttggttttcttcttattctagcagcc
atagagctggcccttgtactcacagaagactctggacaagccacagtccctgctgttcga
tataccaatccaagcctctacctaggcacatggctcctggttttgctgatccaatacagc
agacaatggtgtgtacagaaaaactcctggttcctgtccctattctggattctctcgata
ctctgtggcactttccaatttcagactctgatccggacactcttacagggtgacaattct
aatctagcctactcctgcctgttcttcatctcctacggattccagatcctgatcctgatc
ttttcagcattttcagaaaataatgagtcatcaaataatccatcatccatagcttcattc
ctgagtagcattacctacagctggtatgacagcatcattctgaaaggctacaagcgtcct
ctgacactcgaggatgtctgggaagttgatgaagagatgaaaaccaagacattagtgagc
aagtttgaaacgcacatgaagagagagctgcagaaagccaggcgggcactccagagacgg
caggagaagagctcccagcagaactctggagccaggctgcctggcttgaacaagaatcag
agtcaaagccaagatgcccttgtcctggaagatgttgaaaagaaaaaaaagaagtctggg
accaaaaaagatgttccaaaatcctggttgatgaaggctctgttcaaaactttctacatg
gtgctcctgaaatcattcctactgaagctagtgaatgacatcttcacgtttgtgagtcct
cagctgctgaaattgctgatctcctttgcaagtgaccgtgacacatatttgtggattgga
tatctctgtgcaatcctcttattcactgcggctctcattcagtctttctgccttcagtgt
tatttccaactgtgcttcaagctgggtgtaaaagtacggacagctatcatggcttctgta
tataagaaggcattgaccctatccaacttggccaggaaggagtacaccgttggagaaaca
gtgaacctgatgtctgtggatgcccagaagctcatggatgtgaccaacttcatgcacatg
ctgtggtcaagtgttctacagattgtcttatctatcttcttcctatggagagagttggga
ccctcagtcttagcaggtgttggggtgatggtgcttgtaatcccaattaatgcgatactg
tccaccaagagtaagaccattcaggtcaaaaatatgaagaataaagacaaacgtttaaag
atcatgaatgagattcttagtggaatcaagatcctgaaatattttgcctgggaaccttca
ttcagagaccaagtacaaaacctccggaagaaagagctcaagaacctgctggcctttagt
caactacagtgtgtagtaatattcgtcttccagttaactccagtcctggtatctgtggtc
acattttctgtttatgtcctggtggatagcaacaatattttggatgcacaaaaggccttc
acctccattaccctcttcaatatcctgcgctttcccctgagcatgcttcccatgatgatc
tcctccatgctccaggccagtgtttccacagagcggctagagaagtacttgggaggggat
gacttggacacatctgccattcgacatgactgcaattttgacaaagccatgcagttttct
gaggcctcctttacctgggaacatgattcggaagccacagtccgagatgtgaacctggac
attatggcaggccaacttgtggctgtgataggccctgtcggctctgggaaatcctccttg
atatcagccatgctgggagaaatggaaaatgtccacgggcacatcaccatcaagggcacc
actgcctatgtcccacagcagtcctggattcagaatggcaccataaaggacaacatcctt
tttggaacagagtttaatgaaaagaggtaccagcaagtactggaggcctgtgctctcctc
ccagacttggaaatgctgcctggaggagatttggctgagattggagagaagggtataaat
cttagtgggggtcagaagcagcggatcagcctggccagagctacctaccaaaatttagac
atctatcttctagatgaccccctgtctgcagtggatgctcatgtaggaaaacatattttt
aataaggtcttgggccccaatggcctgttgaaaggcaagactcgactcttggttacacat
agcatgcactttcttcctcaagtggatgagattgtagttctggggaatggaacaattgta
gagaaaggatcctacagtgctctcctggccaaaaaaggagagtttgctaagaatctgaag
acatttctaagacatacaggccctgaagaggaagccacagtccatgatggcagtgaagaa
gaagacgatgactatgggctgatatccagtgtggaagagatccccgaagatgcagcctcc
ataaccatgagaagagagaacagctttcgtcgaacacttagccgcagttctaggtccaat
ggcaggcatctgaagtccctgagaaactccttgaaaactcggaatgtgaatagcctgaag
gaagacgaagaactagtgaaaggacaaaaactaattaagaaggaattcatagaaactgga
aaggtgaagttctccatctacctggagtacctacaagcaataggattgttttcgatattc
ttcatcatccttgcgtttgtgatgaattctgtggcttttattggatccaacctctggctc
agtgcttggaccagtgactctaaaatcttcaatagcaccgactatccagcatctcagagg
gacatgagagttggagtctacggagctctgggattagcccaaggtatatttgtgttcata
gcacatttctggagtgcctttggtttcgtccatgcatcaaatatcttgcacaagcaactg
ctgaacaatatccttcgagcacctatgagattttttgacacaacacccacaggccggatt
gtgaacaggtttgccggcgatatttccacagtggatgacaccctgcctcagtccttgcgc
agctggattacatgcttcctggggataatcagcacccttgtcatgatctgcatggccact
cctgtcttcaccatcatcgtcattcctcttggcattatttatgtatctgttcagatgttt
tatgtgtctacctcccgccagctgaggcgtctggactctgtcaccaggtccccaatctac
tctcacttcagcgagaccgtatcaggtttgccagttatccgtgcctttgagcaccagcag
cgatttctgaaacacaatgaggtgaggattgacaccaaccagaaatgtgtcttttcctgg
atcacctccaacaggtggcttgcaattcgcctggagctggttgggaacctgactgtcttc
ttttcagccttgatgatggttatttatagagataccctaagtggggacactgttggcttt
gttctgtccaatgcactcaatatcacacaaaccctgaactggctggtgaggatgacatca
gaaatagagaccaacattgtggctgttgagcgaataactgagtacacaaaagtggaaaat
gaggcaccctgggtgactgataagaggcctccgccagattggcccagcaaaggcaagatc
cagtttaacaactaccaagtgcggtaccgacctgagctggatctggtcctcagagggatc
acttgtgacatcggtagcatggagaagattggtgtggtgggcaggacaggagctggaaag
tcatccctcacaaactgcctcttcagaatcttagaggctgccggtggtcagattatcatt
gatggagtagatattgcttccattgggctccacgacctccgagagaagctgaccatcatc
ccccaggaccccatcctgttctctggaagcctgaggatgaatctcgaccctttcaacaac
tactcagatgaggagatttggaaggccttggagctggctcacctcaagtcttttgtggcc
agcctgcaacttgggttatcccacgaagtgacagaggctggtggcaacctgagcataggc
cagaggcagctgctgtgcctgggcagggctctgcttcggaaatccaagatcctggtcctg
gatgaggccactgctgcggtggatctagagacagacaacctcattcagacgaccatccaa
aacgagttcgcccactgcacagtgatcaccatcgcccacaggctgcacaccatcatggac
agtgacaaggtaatggtcctagacaacgggaagattatagagtgcggcagccctgaagaa
ctgctacaaatccctggacccttttactttatggctaaggaagctggcattgagaatgtg
aacagcacaaaattctag

DBGET integrated database retrieval system