KEGG   Homo sapiens (human): 1244Help
Entry
1244              CDS       T01001                                 

Gene name
ABCC2, ABC30, CMOAT, DJS, MRP2, cMRP
Definition
ATP-binding cassette, sub-family C (CFTR/MRP), member 2
Orthology
K05666  
ATP-binding cassette, subfamily C (CFTR/MRP), member 2
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
Disease
H00208  
Hyperbilirubinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    1244 (ABCC2)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    1244 (ABCC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q24
AA seq 1545 aa AA seqDB search
MLEKFCNSTFWNSSFLDSPEADLPLCFEQTVLVWIPLGFLWLLAPWQLLHVYKSRTKRSS
TTKLYLAKQVFVGFLLILAAIELALVLTEDSGQATVPAVRYTNPSLYLGTWLLVLLIQYS
RQWCVQKNSWFLSLFWILSILCGTFQFQTLIRTLLQGDNSNLAYSCLFFISYGFQILILI
FSAFSENNESSNNPSSIASFLSSITYSWYDSIILKGYKRPLTLEDVWEVDEEMKTKTLVS
KFETHMKRELQKARRALQRRQEKSSQQNSGARLPGLNKNQSQSQDALVLEDVEKKKKKSG
TKKDVPKSWLMKALFKTFYMVLLKSFLLKLVNDIFTFVSPQLLKLLISFASDRDTYLWIG
YLCAILLFTAALIQSFCLQCYFQLCFKLGVKVRTAIMASVYKKALTLSNLARKEYTVGET
VNLMSVDAQKLMDVTNFMHMLWSSVLQIVLSIFFLWRELGPSVLAGVGVMVLVIPINAIL
STKSKTIQVKNMKNKDKRLKIMNEILSGIKILKYFAWEPSFRDQVQNLRKKELKNLLAFS
QLQCVVIFVFQLTPVLVSVVTFSVYVLVDSNNILDAQKAFTSITLFNILRFPLSMLPMMI
SSMLQASVSTERLEKYLGGDDLDTSAIRHDCNFDKAMQFSEASFTWEHDSEATVRDVNLD
IMAGQLVAVIGPVGSGKSSLISAMLGEMENVHGHITIKGTTAYVPQQSWIQNGTIKDNIL
FGTEFNEKRYQQVLEACALLPDLEMLPGGDLAEIGEKGINLSGGQKQRISLARATYQNLD
IYLLDDPLSAVDAHVGKHIFNKVLGPNGLLKGKTRLLVTHSMHFLPQVDEIVVLGNGTIV
EKGSYSALLAKKGEFAKNLKTFLRHTGPEEEATVHDGSEEEDDDYGLISSVEEIPEDAAS
ITMRRENSFRRTLSRSSRSNGRHLKSLRNSLKTRNVNSLKEDEELVKGQKLIKKEFIETG
KVKFSIYLEYLQAIGLFSIFFIILAFVMNSVAFIGSNLWLSAWTSDSKIFNSTDYPASQR
DMRVGVYGALGLAQGIFVFIAHFWSAFGFVHASNILHKQLLNNILRAPMRFFDTTPTGRI
VNRFAGDISTVDDTLPQSLRSWITCFLGIISTLVMICMATPVFTIIVIPLGIIYVSVQMF
YVSTSRQLRRLDSVTRSPIYSHFSETVSGLPVIRAFEHQQRFLKHNEVRIDTNQKCVFSW
ITSNRWLAIRLELVGNLTVFFSALMMVIYRDTLSGDTVGFVLSNALNITQTLNWLVRMTS
EIETNIVAVERITEYTKVENEAPWVTDKRPPPDWPSKGKIQFNNYQVRYRPELDLVLRGI
TCDIGSMEKIGVVGRTGAGKSSLTNCLFRILEAAGGQIIIDGVDIASIGLHDLREKLTII
PQDPILFSGSLRMNLDPFNNYSDEEIWKALELAHLKSFVASLQLGLSHEVTEAGGNLSIG
QRQLLCLGRALLRKSKILVLDEATAAVDLETDNLIQTTIQNEFAHCTVITIAHRLHTIMD
SDKVMVLDNGKIIECGSPEELLQIPGPFYFMAKEAGIENVNSTKF
NT seq 4638 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaagttctgcaactctactttttggaattcctcattcctggacagtccggag
gcagacctgccactttgttttgagcaaactgttctggtgtggattcccttgggcttccta
tggctcctggccccctggcagcttctccacgtgtataaatccaggaccaagagatcctct
accaccaaactctatcttgctaagcaggtattcgttggttttcttcttattctagcagcc
atagagctggcccttgtactcacagaagactctggacaagccacagtccctgctgttcga
tataccaatccaagcctctacctaggcacatggctcctggttttgctgatccaatacagc
agacaatggtgtgtacagaaaaactcctggttcctgtccctattctggattctctcgata
ctctgtggcactttccaatttcagactctgatccggacactcttacagggtgacaattct
aatctagcctactcctgcctgttcttcatctcctacggattccagatcctgatcctgatc
ttttcagcattttcagaaaataatgagtcatcaaataatccatcatccatagcttcattc
ctgagtagcattacctacagctggtatgacagcatcattctgaaaggctacaagcgtcct
ctgacactcgaggatgtctgggaagttgatgaagagatgaaaaccaagacattagtgagc
aagtttgaaacgcacatgaagagagagctgcagaaagccaggcgggcactccagagacgg
caggagaagagctcccagcagaactctggagccaggctgcctggcttgaacaagaatcag
agtcaaagccaagatgcccttgtcctggaagatgttgaaaagaaaaaaaagaagtctggg
accaaaaaagatgttccaaaatcctggttgatgaaggctctgttcaaaactttctacatg
gtgctcctgaaatcattcctactgaagctagtgaatgacatcttcacgtttgtgagtcct
cagctgctgaaattgctgatctcctttgcaagtgaccgtgacacatatttgtggattgga
tatctctgtgcaatcctcttattcactgcggctctcattcagtctttctgccttcagtgt
tatttccaactgtgcttcaagctgggtgtaaaagtacggacagctatcatggcttctgta
tataagaaggcattgaccctatccaacttggccaggaaggagtacaccgttggagaaaca
gtgaacctgatgtctgtggatgcccagaagctcatggatgtgaccaacttcatgcacatg
ctgtggtcaagtgttctacagattgtcttatctatcttcttcctatggagagagttggga
ccctcagtcttagcaggtgttggggtgatggtgcttgtaatcccaattaatgcgatactg
tccaccaagagtaagaccattcaggtcaaaaatatgaagaataaagacaaacgtttaaag
atcatgaatgagattcttagtggaatcaagatcctgaaatattttgcctgggaaccttca
ttcagagaccaagtacaaaacctccggaagaaagagctcaagaacctgctggcctttagt
caactacagtgtgtagtaatattcgtcttccagttaactccagtcctggtatctgtggtc
acattttctgtttatgtcctggtggatagcaacaatattttggatgcacaaaaggccttc
acctccattaccctcttcaatatcctgcgctttcccctgagcatgcttcccatgatgatc
tcctccatgctccaggccagtgtttccacagagcggctagagaagtacttgggaggggat
gacttggacacatctgccattcgacatgactgcaattttgacaaagccatgcagttttct
gaggcctcctttacctgggaacatgattcggaagccacagtccgagatgtgaacctggac
attatggcaggccaacttgtggctgtgataggccctgtcggctctgggaaatcctccttg
atatcagccatgctgggagaaatggaaaatgtccacgggcacatcaccatcaagggcacc
actgcctatgtcccacagcagtcctggattcagaatggcaccataaaggacaacatcctt
tttggaacagagtttaatgaaaagaggtaccagcaagtactggaggcctgtgctctcctc
ccagacttggaaatgctgcctggaggagatttggctgagattggagagaagggtataaat
cttagtgggggtcagaagcagcggatcagcctggccagagctacctaccaaaatttagac
atctatcttctagatgaccccctgtctgcagtggatgctcatgtaggaaaacatattttt
aataaggtcttgggccccaatggcctgttgaaaggcaagactcgactcttggttacacat
agcatgcactttcttcctcaagtggatgagattgtagttctggggaatggaacaattgta
gagaaaggatcctacagtgctctcctggccaaaaaaggagagtttgctaagaatctgaag
acatttctaagacatacaggccctgaagaggaagccacagtccatgatggcagtgaagaa
gaagacgatgactatgggctgatatccagtgtggaagagatccccgaagatgcagcctcc
ataaccatgagaagagagaacagctttcgtcgaacacttagccgcagttctaggtccaat
ggcaggcatctgaagtccctgagaaactccttgaaaactcggaatgtgaatagcctgaag
gaagacgaagaactagtgaaaggacaaaaactaattaagaaggaattcatagaaactgga
aaggtgaagttctccatctacctggagtacctacaagcaataggattgttttcgatattc
ttcatcatccttgcgtttgtgatgaattctgtggcttttattggatccaacctctggctc
agtgcttggaccagtgactctaaaatcttcaatagcaccgactatccagcatctcagagg
gacatgagagttggagtctacggagctctgggattagcccaaggtatatttgtgttcata
gcacatttctggagtgcctttggtttcgtccatgcatcaaatatcttgcacaagcaactg
ctgaacaatatccttcgagcacctatgagattttttgacacaacacccacaggccggatt
gtgaacaggtttgccggcgatatttccacagtggatgacaccctgcctcagtccttgcgc
agctggattacatgcttcctggggataatcagcacccttgtcatgatctgcatggccact
cctgtcttcaccatcatcgtcattcctcttggcattatttatgtatctgttcagatgttt
tatgtgtctacctcccgccagctgaggcgtctggactctgtcaccaggtccccaatctac
tctcacttcagcgagaccgtatcaggtttgccagttatccgtgcctttgagcaccagcag
cgatttctgaaacacaatgaggtgaggattgacaccaaccagaaatgtgtcttttcctgg
atcacctccaacaggtggcttgcaattcgcctggagctggttgggaacctgactgtcttc
ttttcagccttgatgatggttatttatagagataccctaagtggggacactgttggcttt
gttctgtccaatgcactcaatatcacacaaaccctgaactggctggtgaggatgacatca
gaaatagagaccaacattgtggctgttgagcgaataactgagtacacaaaagtggaaaat
gaggcaccctgggtgactgataagaggcctccgccagattggcccagcaaaggcaagatc
cagtttaacaactaccaagtgcggtaccgacctgagctggatctggtcctcagagggatc
acttgtgacatcggtagcatggagaagattggtgtggtgggcaggacaggagctggaaag
tcatccctcacaaactgcctcttcagaatcttagaggctgccggtggtcagattatcatt
gatggagtagatattgcttccattgggctccacgacctccgagagaagctgaccatcatc
ccccaggaccccatcctgttctctggaagcctgaggatgaatctcgaccctttcaacaac
tactcagatgaggagatttggaaggccttggagctggctcacctcaagtcttttgtggcc
agcctgcaacttgggttatcccacgaagtgacagaggctggtggcaacctgagcataggc
cagaggcagctgctgtgcctgggcagggctctgcttcggaaatccaagatcctggtcctg
gatgaggccactgctgcggtggatctagagacagacaacctcattcagacgaccatccaa
aacgagttcgcccactgcacagtgatcaccatcgcccacaggctgcacaccatcatggac
agtgacaaggtaatggtcctagacaacgggaagattatagagtgcggcagccctgaagaa
ctgctacaaatccctggacccttttactttatggctaaggaagctggcattgagaatgtg
aacagcacaaaattctag

DBGET integrated database retrieval system