KEGG   Homo sapiens (human): 124538Help
Entry
124538            CDS       T01001                                 

Gene name
OR4D2, BC2009, OR17-24
Definition
olfactory receptor, family 4, subfamily D, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    124538 (OR4D2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    124538 (OR4D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 307 aa AA seqDB search
METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY
FLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF
DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTC
TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRR
LGRHRLV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagggaacctcacgtgggtatcagactttgtcttcctggggctctcgcagact
cgggagctccagcgtttcctgtttctaatgttcctgtttgtctacatcaccactgttatg
ggaaacatccttatcatcatcacagtgacctctgattcccagctccacacacccatgtac
tttctgctccgaaacctggctgtcctagacctctgtttctcttcagtcactgctcccaaa
atgctagtggacctcctctctgagaagaaaaccatctcttaccagggctgcatgggtcag
atcttcttcttccactttttgggaggtgccatggtcttcttcctctcagtgatggccttt
gaccgcctcattgccatctcccggcccctccgctatgtcaccgtcatgaacactcagctc
tgggtggggctggtggtagccacctgggtgggaggctttgtccactctattgtccagctg
gctctgatgctcccactgcccttctgtggccccaacattttggataacttctactgtgat
gttccccaagtactgagacttgcctgcactgacacctcactgctggagttcctcaagatc
tccaacagtgggctgctggatgtcgtctggttcttcctcctcctgatgtcctacttattc
atcctggtgatgctgaggtcacatccaggggaggcaagaaggaaggcagcttccacctgc
accacccacatcatcgtggtttccatgatcttcgttccaagcatttacctctatgcccgg
cccttcactccattccctatggacaagcttgtgtccatcggccacacagtcatgaccccc
atgctcaaccccatgatctataccctgaggaaccaggacatgcaggcagcagtgagaaga
ttagggagacaccggctggtttga

DBGET integrated database retrieval system