KEGG   Homo sapiens (human): 124538Help
Entry
124538            CDS       T01001                                 

Gene name
OR4D2, BC2009, OR17-24
Definition
(RefSeq) olfactory receptor family 4 subfamily D member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    124538 (OR4D2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    124538 (OR4D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 124538
NCBI-ProteinID: NP_001004707
HGNC: 8294
Ensembl: ENSG00000255713
Vega: OTTHUMG00000178801
Pharos: P58180(Tdark)
UniProt: P58180 A0A126GWK0
Position
17q22
AA seq 307 aa AA seqDB search
METGNLTWVSDFVFLGLSQTRELQRFLFLMFLFVYITTVMGNILIIITVTSDSQLHTPMY
FLLRNLAVLDLCFSSVTAPKMLVDLLSEKKTISYQGCMGQIFFFHFLGGAMVFFLSVMAF
DRLIAISRPLRYVTVMNTQLWVGLVVATWVGGFVHSIVQLALMLPLPFCGPNILDNFYCD
VPQVLRLACTDTSLLEFLKISNSGLLDVVWFFLLLMSYLFILVMLRSHPGEARRKAASTC
TTHIIVVSMIFVPSIYLYARPFTPFPMDKLVSIGHTVMTPMLNPMIYTLRNQDMQAAVRR
LGRHRLV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagggaacctcacgtgggtatcagactttgtcttcctggggctctcgcagact
cgggagctccagcgtttcctgtttctaatgttcctgtttgtctacatcaccactgttatg
ggaaacatccttatcatcatcacagtgacctctgattcccagctccacacacccatgtac
tttctgctccgaaacctggctgtcctagacctctgtttctcttcagtcactgctcccaaa
atgctagtggacctcctctctgagaagaaaaccatctcttaccagggctgcatgggtcag
atcttcttcttccactttttgggaggtgccatggtcttcttcctctcagtgatggccttt
gaccgcctcattgccatctcccggcccctccgctatgtcaccgtcatgaacactcagctc
tgggtggggctggtggtagccacctgggtgggaggctttgtccactctattgtccagctg
gctctgatgctcccactgcccttctgtggccccaacattttggataacttctactgtgat
gttccccaagtactgagacttgcctgcactgacacctcactgctggagttcctcaagatc
tccaacagtgggctgctggatgtcgtctggttcttcctcctcctgatgtcctacttattc
atcctggtgatgctgaggtcacatccaggggaggcaagaaggaaggcagcttccacctgc
accacccacatcatcgtggtttccatgatcttcgttccaagcatttacctctatgcccgg
cccttcactccattccctatggacaagcttgtgtccatcggccacacagtcatgaccccc
atgctcaaccccatgatctataccctgaggaaccaggacatgcaggcagcagtgagaaga
ttagggagacaccggctggtttga

DBGET integrated database retrieval system