KEGG   Homo sapiens (human): 124590Help
Entry
124590            CDS       T01001                                 

Gene name
USH1G, ANKS4A, SANS
Definition
(RefSeq) USH1 protein network component sans
Organism
hsa  Homo sapiens (human)
Disease
H00779  
Usher syndrome (US)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 461 aa AA seqDB search
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSS
LTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKS
ARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSPSLDDDSLGSA
NSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML
CSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccagtaccaccgggcagcccgggatggctacctggagctcctcaaggaggcc
acccgaaaggagctgaatgcccccgacgaggatggcatgacccccactctctgggctgcc
taccatggcaacctcgagtcgctgcgtctcattgtgagccgcgggggtgacccggacaag
tgtgacatctggggcaacacacccctgcatctggcagcttccaatggccacttgcactgc
ctgtccttcctggtgtccttcggagccaacatctggtgcctagacaacgactaccacacg
ccgctggacatggctgccatgaagggccacatggaatgcgtgcgctacctggactccatc
gcggccaagcagagcagcctcaaccccaagctggtgggtaagctgaaggacaaggccttc
cgcgaggcggagcggcgcatccgcgagtgcgccaagctgcagcggaggcaccacgaacgc
atggagcggcgataccggcgcgagctggccgagcgttccgacaccctcagcttctccagc
ctcacgtccagcaccctgagccgccggctgcagcatctggcgctgggcagccacctgccg
tactctcaggccacgctgcacggcacggccaggggcaagaccaagatgcagaagaagctg
gagcggcgcaagcagggcggcgaaggcaccttcaaggtctccgaggatgggcgcaagagc
gcccgctcgctctcgggcctgcagctgggcagcgacgtgatgttcgtgcgccagggcacc
tacgccaatcccaaggagtggggccgagccccgctccgggacatgttcctctcggacgag
gacagcgtctcccgtgccacgctggcggccgagcctgcccactcggaggtcagcaccgac
tcaggccacgactccctgtttacccgccccggcctgggcaccatggtgttccgcagaaat
tacttgagcagtgggctgcacggactgggccgcgaggatgggggtctggatggggtggga
gcgccgcggggtcggctgcagagctcccccagcctggacgatgacagcctgggcagtgcc
aacagcctgcaggaccgcagctgtggggaggagctgccctgggatgagctcgatttaggc
ttggacgaggacctggagcccgagactagcccgctggagaccttcctggcctctctgcac
atggaggactttgccgccctcctgcggcaggagaagatcgacctcgaggctttgatgctg
tgctctgacctcgacctccgcagcatcagcgtcccactggggccccgaaagaagatcttg
ggggccgtgaggaggcggcggcaggcgatggagcgcccgccggccctggaggacacagag
ctataa

DBGET integrated database retrieval system