KEGG   Homo sapiens (human): 124590Help
Entry
124590            CDS       T01001                                 

Gene name
USH1G, ANKS4A, SANS
Definition
Usher syndrome 1G (autosomal recessive)
Organism
hsa  Homo sapiens (human)
Disease
H00779  
Usher syndrome (US)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 358 aa AA seqDB search
MAAMKGHMECVRYLDSIAAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMER
RYRRELAERSDTLSFSSLTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERR
KQGGEGTFKVSEDGRKSARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSV
SRATLAAEPAHSEVSTDSGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPR
GRLQSSPSLDDDSLGSANSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMED
FAALLRQEKIDLEALMLCSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatgaagggccacatggaatgcgtgcgctacctggactccatcgcggccaag
cagagcagcctcaaccccaagctggtgggtaagctgaaggacaaggccttccgcgaggcg
gagcggcgcatccgcgagtgcgccaagctgcagcggaggcaccacgaacgcatggagcgg
cgataccggcgcgagctggccgagcgttccgacaccctcagcttctccagcctcacgtcc
agcaccctgagccgccggctgcagcatctggcgctgggcagccacctgccgtactctcag
gccacgctgcacggcacggccaggggcaagaccaagatgcagaagaagctggagcggcgc
aagcagggcggcgaaggcaccttcaaggtctccgaggatgggcgcaagagcgcccgctcg
ctctcgggcctgcagctgggcagcgacgtgatgttcgtgcgccagggcacctacgccaat
cccaaggagtggggccgagccccgctccgggacatgttcctctcggacgaggacagcgtc
tcccgtgccacgctggcggccgagcctgcccactcggaggtcagcaccgactcaggccac
gactccctgtttacccgccccggcctgggcaccatggtgttccgcagaaattacttgagc
agtgggctgcacggactgggccgcgaggatgggggtctggatggggtgggagcgccgcgg
ggtcggctgcagagctcccccagcctggacgatgacagcctgggcagtgccaacagcctg
caggaccgcagctgtggggaggagctgccctgggatgagctcgatttaggcttggacgag
gacctggagcccgagactagcccgctggagaccttcctggcctctctgcacatggaggac
tttgccgccctcctgcggcaggagaagatcgacctcgaggctttgatgctgtgctctgac
ctcgacctccgcagcatcagcgtcccactggggccccgaaagaagatcttgggggccgtg
aggaggcggcggcaggcgatggagcgcccgccggccctggaggacacagagctataa

DBGET integrated database retrieval system