KEGG   Homo sapiens (human): 124590Help
Entry
124590            CDS       T01001                                 

Gene name
USH1G, ANKS4A, SANS
Definition
(RefSeq) USH1 protein network component sans
  KO
K21414  
ankyrin repeat and SAM domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Disease
H00779  
Usher syndrome (US)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q495M9(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
17q25.1
AA seq 461 aa AA seqDB search
MNDQYHRAARDGYLELLKEATRKELNAPDEDGMTPTLWAAYHGNLESLRLIVSRGGDPDK
CDIWGNTPLHLAASNGHLHCLSFLVSFGANIWCLDNDYHTPLDMAAMKGHMECVRYLDSI
AAKQSSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHERMERRYRRELAERSDTLSFSS
LTSSTLSRRLQHLALGSHLPYSQATLHGTARGKTKMQKKLERRKQGGEGTFKVSEDGRKS
ARSLSGLQLGSDVMFVRQGTYANPKEWGRAPLRDMFLSDEDSVSRATLAAEPAHSEVSTD
SGHDSLFTRPGLGTMVFRRNYLSSGLHGLGREDGGLDGVGAPRGRLQSSPSLDDDSLGSA
NSLQDRSCGEELPWDELDLGLDEDLEPETSPLETFLASLHMEDFAALLRQEKIDLEALML
CSDLDLRSISVPLGPRKKILGAVRRRRQAMERPPALEDTEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaccagtaccaccgggcagcccgggatggctacctggagctcctcaaggaggcc
acccgaaaggagctgaatgcccccgacgaggatggcatgacccccactctctgggctgcc
taccatggcaacctcgagtcgctgcgtctcattgtgagccgcgggggtgacccggacaag
tgtgacatctggggcaacacacccctgcatctggcagcttccaatggccacttgcactgc
ctgtccttcctggtgtccttcggagccaacatctggtgcctagacaacgactaccacacg
ccgctggacatggctgccatgaagggccacatggaatgcgtgcgctacctggactccatc
gcggccaagcagagcagcctcaaccccaagctggtgggtaagctgaaggacaaggccttc
cgcgaggcggagcggcgcatccgcgagtgcgccaagctgcagcggaggcaccacgaacgc
atggagcggcgataccggcgcgagctggccgagcgttccgacaccctcagcttctccagc
ctcacgtccagcaccctgagccgccggctgcagcatctggcgctgggcagccacctgccg
tactctcaggccacgctgcacggcacggccaggggcaagaccaagatgcagaagaagctg
gagcggcgcaagcagggcggcgaaggcaccttcaaggtctccgaggatgggcgcaagagc
gcccgctcgctctcgggcctgcagctgggcagcgacgtgatgttcgtgcgccagggcacc
tacgccaatcccaaggagtggggccgagccccgctccgggacatgttcctctcggacgag
gacagcgtctcccgtgccacgctggcggccgagcctgcccactcggaggtcagcaccgac
tcaggccacgactccctgtttacccgccccggcctgggcaccatggtgttccgcagaaat
tacttgagcagtgggctgcacggactgggccgcgaggatgggggtctggatggggtggga
gcgccgcggggtcggctgcagagctcccccagcctggacgatgacagcctgggcagtgcc
aacagcctgcaggaccgcagctgtggggaggagctgccctgggatgagctcgatttaggc
ttggacgaggacctggagcccgagactagcccgctggagaccttcctggcctctctgcac
atggaggactttgccgccctcctgcggcaggagaagatcgacctcgaggctttgatgctg
tgctctgacctcgacctccgcagcatcagcgtcccactggggccccgaaagaagatcttg
ggggccgtgaggaggcggcggcaggcgatggagcgcccgccggccctggaggacacagag
ctataa

DBGET integrated database retrieval system