KEGG   Homo sapiens (human): 124801Help
Entry
124801            CDS       T01001                                 

Gene name
LSM12, PNAS-135
Definition
LSM12 homolog (S. cerevisiae)
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.31
AA seq 195 aa AA seqDB search
MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINL
QYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTI
HKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQ
RSQAQQPQKEAALSS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcctccgggcgagtacttcagcgttgggagccaggtgtcgtgccggacgtgc
caggagcagcggctgcagggcgaggtggtagcctttgactaccaatccaaaatgctggct
ttaaaatgtccctcttccagtggaaagcccaaccatgcagacatcttgctcataaactta
cagtatgtttcagaagtggaaataattaatgaccgaacagaaacccctcctcccctagct
tcactcaatgttagtaagcttgccagcaaagcacggacagagaaggaggagaagctgagc
caggcctatgcaatcagtgctggtgtctctctagagggccagcagctcttccagaccatt
cacaagaccattaaagactgtaaatggcaagaaaaaaacatcgtagtcatggaagaagtt
gttattacacccccatatcaagtggaaaactgtaaaggcaaagaggggagtgcactgagc
catgtacgcaaaatagttgaaaaacattttagagacgtggaaagccaaaagatactgcaa
cgttcacaagcccagcaaccacagaaggaggctgccctgtcatcctga

DBGET integrated database retrieval system