KEGG   Homo sapiens (human): 124801Help
Entry
124801            CDS       T01001                                 

Gene name
LSM12, PNAS-135
Definition
(RefSeq) LSM12 homolog
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: AD Gemin6
Motif
Other DBs
NCBI-GeneID: 124801
NCBI-ProteinID: NP_689557
OMIM: 611793
HGNC: 26407
Ensembl: ENSG00000161654
Vega: OTTHUMG00000181804
Pharos: Q3MHD2(Tdark)
UniProt: Q3MHD2
Position
17q21.31
AA seq 195 aa AA seqDB search
MAAPPGEYFSVGSQVSCRTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHADILLINL
QYVSEVEIINDRTETPPPLASLNVSKLASKARTEKEEKLSQAYAISAGVSLEGQQLFQTI
HKTIKDCKWQEKNIVVMEEVVITPPYQVENCKGKEGSALSHVRKIVEKHFRDVESQKILQ
RSQAQQPQKEAALSS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcctccgggcgagtacttcagcgttgggagccaggtgtcgtgccggacgtgc
caggagcagcggctgcagggcgaggtggtagcctttgactaccaatccaaaatgctggct
ttaaaatgtccctcttccagtggaaagcccaaccatgcagacatcttgctcataaactta
cagtatgtttcagaagtggaaataattaatgaccgaacagaaacccctcctcccctagct
tcactcaatgttagtaagcttgccagcaaagcacggacagagaaggaggagaagctgagc
caggcctatgcaatcagtgctggtgtctctctagagggccagcagctcttccagaccatt
cacaagaccattaaagactgtaaatggcaagaaaaaaacatcgtagtcatggaagaagtt
gttattacacccccatatcaagtggaaaactgtaaaggcaaagaggggagtgcactgagc
catgtacgcaaaatagttgaaaaacattttagagacgtggaaagccaaaagatactgcaa
cgttcacaagcccagcaaccacagaaggaggctgccctgtcatcctga

DBGET integrated database retrieval system