KEGG   Homo sapiens (human): 125061Help
Entry
125061            CDS       T01001                                 

Gene name
AFMID, FKF, KF, KFA
Definition
arylformamidase (EC:3.5.1.9)
Orthology
K01432  
arylformamidase [EC:3.5.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    125061 (AFMID)
  Amino acid metabolism
   00380 Tryptophan metabolism
    125061 (AFMID)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     125061 (AFMID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q25.3
AA seq 303 aa AA seqDB search
MMDVSGVGFPSKVPWKKMSAEELENQYCPSRWVVRLGAEEALRTYSQIGIEATTRARATR
KSLLHVPYGDGEGEKVDIYFPDESSEALPFFLFFHGGYWQSGSKDESAFMVHPLTAQGVA
VVIVAYGIAPKGTLDHMVDQVTRSVAFVQKRYPSNKGIYLCGHSAGAHLAAMMLLADWTK
HGVTPNLRGFFLVSGVFDLEPIVYTSQNVALQLTLEDAQRNSPQLKVAQAQPVDPTCRVL
VVVGQFDSPEFHRQSWEFYQTLCQGEWKASFEELHDVDHFEIVENLTQKDNVLTQIILKT
IFQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgtgtctggtgtgggtttcccaagcaaggttccttggaagaagatgtctgca
gaggagctggagaatcagtactgtcccagccgatgggttgtccgactgggagcagaggaa
gccttgaggacctactcacagataggaattgaagccaccacaagggcccgggccaccagg
aagagcctgctgcatgtcccctatggagacggcgaaggggagaaagtggacatttacttc
cccgacgagtcgtctgaagccttgcctttcttcctgttctttcacggaggatactggcag
agcggaagtaaggatgagtctgccttcatggtccacccgctgacggcacagggagtggcc
gtggtaatagtggcttacggcatcgcccccaaaggcaccctggaccacatggtagaccag
gtgacccgcagcgttgcgtttgtccagaagcggtatccaagcaacaagggaatttacctg
tgtggacactcagccggggcccacctggctgccatgatgctcctggccgactggaccaag
catggggtcacgcccaacctcagaggctttttcctggtgagtggggtctttgacctggag
cccatcgtgtatacttcacagaacgttgctctccagctgaccctggaggacgctcagagg
aatagcccccagctgaaggtggcccaggcacagccggtggaccccacctgccgtgtgctg
gtggtcgtgggccagttcgactcccccgaattccaccgacagtcctgggagttttaccag
accctgtgtcaaggagagtggaaagcctcatttgaagagctccacgatgtggaccacttt
gaaattgttgagaatctgacccagaaggacaacgtgctcacccagattatcttgaaaaca
atcttccagtag

DBGET integrated database retrieval system