KEGG   Homo sapiens (human): 1259Help
Entry
1259              CDS       T01001                                 

Gene name
CNGA1, CNCG, CNCG1, CNG-1, CNG1, RCNC1, RCNCa, RCNCalpha, RP49
Definition
cyclic nucleotide gated channel alpha 1
Orthology
K04948  
cyclic nucleotide gated channel alpha 1
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Phototransduction
Disease
H00527  
Retinitis pigmentosa (RP)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    1259 (CNGA1)
 Organismal Systems
  Sensory system
   04744 Phototransduction
    1259 (CNGA1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1259 (CNGA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p12
AA seq 690 aa AA seqDB search
MKLSMKNNIINTQQSFVTMPNVIVPDIEKEIRRMENGACSSFSEDDDSASTSEESENENP
HARGSFSYKSLRKGGPSQREQYLPGAIALFNVNNSSNKDQEPEEKKKKKKEKKSKSDDKN
ENKNDPEKKKKKKDKEKKKKEEKSKDKKEEEKKEVVVIDPSGNTYYNWLFCITLPVMYNW
TMVIARACFDELQSDYLEYWLILDYVSDIVYLIDMFVRTRTGYLEQGLLVKEELKLINKY
KSNLQFKLDVLSLIPTDLLYFKLGWNYPEIRLNRLLRFSRMFEFFQRTETRTNYPNIFRI
SNLVMYIVIIIHWNACVFYSISKAIGFGNDTWVYPDINDPEFGRLARKYVYSLYWSTLTL
TTIGETPPPVRDSEYVFVVVDFLIGVLIFATIVGNIGSMISNMNAARAEFQARIDAIKQY
MHFRNVSKDMEKRVIKWFDYLWTNKKTVDEKEVLKYLPDKLRAEIAINVHLDTLKKVRIF
ADCEAGLLVELVLKLQPQVYSPGDYICKKGDIGREMYIIKEGKLAVVADDGVTQFVVLSD
GSYFGEISILNIKGSKAGNRRTANIKSIGYSDLFCLSKDDLMEALTEYPDAKTMLEEKGK
QILMKDGLLDLNIANAGSDPKDLEEKVTRMEGSVDLLQTRFARILAEYESMQQKLKQRLT
KVEKFLKPLIDTEFSSIEGPGAESGPIDST
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatccatgaagaacaatattatcaatacacagcagtcttttgtaaccatgccc
aatgtgattgtaccagatattgaaaaggaaatacgaaggatggaaaatggagcatgcagc
tccttttctgaggatgatgacagtgcctctacatctgaagaatcagagaatgaaaaccct
catgcaaggggttcctttagttataagtcactcagaaagggaggaccatcacagagggag
cagtacctgcctggtgccattgcactttttaatgtgaacaacagcagcaataaggaccag
gaaccagaagaaaaaaagaaaaagaaaaaagaaaagaagagcaagtcagatgataaaaac
gaaaataaaaacgacccagagaagaaaaagaagaaaaaggacaaagagaagaaaaagaaa
gaggagaaaagcaaagataagaaagaagaggagaagaaagaagttgtggttattgatccc
tcgggaaacacatattacaactggctgttttgcatcacattacctgttatgtacaactgg
acaatggttattgccagagcatgttttgatgaacttcaatctgattacctagaatattgg
ctcattttggattacgtatcagacatagtctatttaatcgatatgtttgtacgaacaagg
acaggttacctagaacaaggactgctggtaaaggaagaacttaaactcataaataaatat
aaatccaacttgcaatttaaacttgatgttctgtcactgataccaactgatttgctgtat
tttaagttagggtggaactatccagaaattagattaaacaggttgttacggttctctcgt
atgtttgagttcttccagagaacagaaacaaggacaaactatccaaacatcttcaggatt
tccaaccttgttatgtatatcgtcatcattatccactggaatgcatgtgtgttctactct
atttctaaagctattggatttggaaatgatacatgggtctaccctgatattaatgatcct
gaatttggccgtttggctagaaaatacgtatacagcctttactggtctacactgactttg
actaccattggtgaaacaccccctcccgtgagggattctgagtatgtctttgtggtggtt
gatttcctaattggagtgttaatttttgctaccatcgttggtaacataggttctatgatt
tccaacatgaatgcagccagagcagaatttcaagcaagaattgatgctatcaagcaatat
atgcattttcgaaatgtaagcaaagatatggaaaagagggttattaaatggtttgactac
ctgtggaccaacaaaaaaacagttgatgagaaagaagtcttaaagtatctacctgataaa
ctaagagcagaaattgccatcaacgttcacttagacacattaaaaaaggtacgcattttt
gctgattgtgaagctggtctgttggtggagttggtcttgaaattgcaaccccaagtctac
agtcctggagattatatttgcaagaaaggggatatcggacgagagatgtacattatcaag
gaaggcaaactcgctgtggtggcagatgatggagtcactcagtttgtggtattgagcgat
ggcagctacttcggtgagatcagcattcttaacattaaagggagcaaagctggcaatcga
agaacggccaatattaaaagtattggctactcagacctgttctgtctctcaaaagatgac
ctcatggaagctctaactgagtacccagatgccaaaactatgctggaagagaaagggaag
cagattttaatgaaagatggtctactggatctaaacattgcaaatgctggcagtgatcct
aaagatcttgaagagaaggttactcgaatggaggggtcagtagacctcctgcaaaccagg
tttgcccgaatcttggctgagtatgagtccatgcagcagaaactgaaacaaagattaacc
aaggttgagaaatttctgaaaccgcttattgacacagaattttcaagtattgagggacct
ggagcggaaagtgggcccatcgactctacatag

DBGET integrated database retrieval system