KEGG   Homo sapiens (human): 125962Help
Entry
125962            CDS       T01001                                 

Gene name
OR7G1, OR19-15, OR19-8, OR7G1P
Definition
olfactory receptor, family 7, subfamily G, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    125962 (OR7G1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    125962 (OR7G1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.2
AA seq 311 aa AA seqDB search
MGPRNQTAVSEFLLMKVTEDPELKLIPFSLFLSMYLVTILGNLLILLAVISDSHLHTPMY
FLLFNLSFTDICLTTTTVPKILVNIQAQNQSITYTGCLTQICLVLVFAGLESCFLAVMAY
DRYVAICHPLRYTVLMNVHFWGLLILLSMFMSTMDALVQSLMVLQLSFCKNVEIPLFFCE
VVQVIKLACSDTLINNILIYFASSVFGAIPLSGIIFSYSQIVTSVLRMPSARGKYKAFST
CGCHLSVFSLFYGTAFGVYISSAVAESSRITAVASVMYTVVPQMMNPFIYSLRNKEMKKA
LRKLIGRLFPF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggacccagaaaccaaacagctgtttcagaatttcttctcatgaaagtgacagaggac
ccagaactgaagttaatccctttcagcctgttcctgtccatgtacctggtcaccatcctg
gggaacctgctcattctcctggctgtcatctctgactcccacctccacacccccatgtac
ttccttctctttaatctctcctttactgacatctgtttaaccacaaccacagtcccaaag
atcctagtgaacatccaagctcagaatcagagtatcacttacacaggctgcctcacccag
atctgtcttgtcttggtttttgctggcttggaaagttgctttcttgcagtcatggcctac
gaccgctatgtggccatttgccacccactgaggtacacagtcctcatgaatgtccatttc
tggggcttgctgattcttctctccatgttcatgagcactatggatgccctggttcagagt
ctgatggtattgcagctgtccttctgcaaaaacgttgaaatccctttgttcttctgtgaa
gtcgttcaggtcatcaagctcgcctgttctgacaccctcatcaacaacatcctcatatat
tttgcaagtagtgtatttggtgcaattcctctctctggaataattttctcttattctcaa
atagtcacctctgttctgagaatgccatcagcaagaggaaagtataaagcgttttccacc
tgtggctgtcacctctctgttttttccttgttctatgggacagcttttggggtgtacatt
agttctgctgttgctgagtcttcccgaattactgctgtggcttcagtgatgtacactgtg
gtccctcaaatgatgaaccccttcatctacagcctgagaaataaggagatgaagaaagct
ttgaggaaacttattggtaggctgtttcctttttag

DBGET integrated database retrieval system