KEGG   Homo sapiens (human): 125963Help
Entry
125963            CDS       T01001                                 

Gene name
OR1M1, OR19-5, OR19-6
Definition
(RefSeq) olfactory receptor family 1 subfamily M member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    125963 (OR1M1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    125963 (OR1M1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 125963
NCBI-ProteinID: NP_001004456
HGNC: 8220
Ensembl: ENSG00000170929
Vega: OTTHUMG00000179930
Pharos: Q8NGA1(Tdark)
UniProt: Q8NGA1
Position
19p13.2
AA seq 313 aa AA seqDB search
MEPRNQTSASQFILLGLSEKPEQETLLFSLFFCMYLVMVVGNLLIILAISIDSHLHTPMY
FFLANLSLVDFCLATNTIPKMLVSLQTGSKAISYPCCLIQMYFFHFFGIVDSVIIAMMAY
DRFVAICHPLHYAKIMSLRLCRLLVGALWAFSCFISLTHILLMARLVFCGSHEVPHYFCD
LTPILRLSCTDTSVNRIFILIVAGMVIATPFVCILASYARILVAIMKVPSAGGRKKAFST
CSSHLSVVALFYGTTIGVYLCPSSVLTTVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA
LRKLVNRKITSSS
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaagaaaccaaaccagtgcatctcaattcatcctcctgggactctcagaaaag
ccagagcaggagacgcttctcttttccctgttcttctgcatgtacctggtcatggtcgtg
gggaacctgctcatcatcctggccatcagcatagactcccacctccacacccccatgtac
ttcttcctggccaacctgtccctggttgatttctgtctggccaccaacaccatccctaag
atgctggtgagccttcaaaccgggagcaaggccatctcttatccctgctgcctgatccag
atgtacttcttccatttctttggcatcgtggacagcgtcataatcgccatgatggcttat
gaccggttcgtggccatctgccacccattgcactacgccaagatcatgagcctacgcctc
tgtcgcctgctggtcggcgccctctgggcgttttcctgcttcatctcactcactcacatc
ctcctgatggcccgtctcgttttctgcggcagccatgaggtgcctcactacttctgcgac
ctcactcccatcctccgactttcgtgcacggacacctctgtgaataggatcttcatcctc
attgtggcagggatggtgatagccacgccctttgtctgcatcctggcctcctatgctcgc
atccttgtggccatcatgaaggtcccctctgcaggcggcaggaagaaagccttctccacc
tgcagctcccacctgtctgtggttgctctcttctatgggaccaccattggcgtctatctg
tgtccctcctcggtcctcaccactgtgaaggagaaagcttctgcggtgatgtacacagca
gtcacccccatgctgaatcccttcatctacagcttgaggaacagagacctgaaaggggct
ctcaggaagctggtcaacagaaagatcacctcatcttcctga

DBGET integrated database retrieval system