KEGG   Homo sapiens (human): 125965Help
Entry
125965            CDS       T01001                                 

Gene name
COX6B2, COXVIB2, CT59
Definition
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  
cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    125965 (COX6B2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    125965 (COX6B2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    125965 (COX6B2)
   05012 Parkinson's disease
    125965 (COX6B2)
   05016 Huntington's disease
    125965 (COX6B2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    125965 (COX6B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.42
AA seq 88 aa AA seqDB search
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYF
RVYHSLCPISWVESWNEQIKNGIFAGKI
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtggaagcccaggagccccccaaggggaaatggtcgacgccgcccttcgac
ccgcgcttccccagccagaaccagatccgtaactgctaccagaacttcctggactaccac
cgctgcctcaagaccaggacccgccgcgggaagagcacgcagccctgcgagtactatttc
cgcgtgtaccactcgctgtgccccatcagctgggtggagagctggaacgagcagatcaag
aacgggattttcgccggcaaaatctga

DBGET integrated database retrieval system