KEGG   Homo sapiens (human): 125972Help
Entry
125972            CDS       T01001                                 

Gene name
CALR3, CMH19, CRT2, CT93
Definition
calreticulin 3
Orthology
K10098  
calreticulin 3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.11
AA seq 384 aa AA seqDB search
MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHK
EKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQK
NLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDL
SYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQ
SDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAI
GLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEE
EELLSGKINRHEHYFNQFHRRNEL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggctttggtccagctctgggccatatgcatgctgcgagtggcgctggctacc
gtctatttccaagaggaatttctagacggagagcattggagaaaccgatggttgcagtcc
accaatgactcccgatttgggcattttagactttcgtcgggcaagttttatggtcataaa
gagaaagataaaggtctgcaaaccactcagaatggccgattctatgccatctctgcacgc
ttcaaaccgttcagcaataaagggaaaactctggttattcagtacacagtaaaacatgag
cagaagatggactgtggagggggctacattaaggtctttcctgcagacattgaccagaag
aacctgaatggaaaatcgcagtactatattatgtttggacccgatatttgtggatttgat
atcaagaaagttcatgttattttacatttcaagaataagtatcacgaaaacaagaaactg
atcaggtgtaaggttgatggcttcacacacctgtacactctaattttaagaccagatctt
tcttatgatgtgaaaattgatggtcagtcaattgaatccggcagcatagagtacgactgg
aacttaacatcactcaagaaggaaacgtccccggcagaatcgaaggattgggaacagact
aaagacaacaaagcccaggactgggagaagcattttctggacgccagcaccagcaagcag
agcgactggaacggtgacctggatggggactggccagcgccgatgctccagaagcccccg
taccaggatggcctgaaaccagaaggtattcataaagacgtctggctccaccgtaagatg
aagaataccgactatttgacgcagtatgacctctcagaatttgagaacattggtgccatt
ggcctggagctttggcaggtgagatctggaaccatttttgataactttctgatcacagat
gatgaagagtacgcagataattttggcaaggccacctggggcgaaaccaagggtccagaa
agggagatggatgccatacaggccaaggaggaaatgaagaaggcccgcgaggaagaggag
gaagagctgctgtcgggaaaaattaacaggcacgaacattacttcaatcaatttcacaga
aggaatgaactttag

DBGET integrated database retrieval system