KEGG   Homo sapiens (human): 126119Help
Entry
126119            CDS       T01001                                 

Gene name
JOSD2
Definition
Josephin domain containing 2 (EC:3.4.19.12)
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     126119 (JOSD2)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C86
   126119 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccacccaccgtgtaccacgaacggcagcgc
ctggagctgtgtgctgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgatgtcaatgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtactggggctgatcctgaacctgccctcgcccgtgtcgctggggctgctgtcactgccg
ctgcgccggcggcactgggtggccctgcgccaggtggacggtgtctactacaacctggac
tccaagctgcgggcgcccgaggccctgggggatgaggacggagtcagggccttcctggcg
gctgcgctggcccagggcctgtgcgaggtgctgctggtagtgaccaaggaggtggaggag
aagggcagctggctgcggacagactga

DBGET integrated database retrieval system