KEGG   Homo sapiens (human): 126129Help
Entry
126129            CDS       T01001                                 

Gene name
CPT1C, CATL1, CPT1-B, CPT1P, CPTI-B, CPTIC
Definition
carnitine palmitoyltransferase 1C (EC:2.3.1.21)
Orthology
K08765  
carnitine O-palmitoyltransferase 1 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
Adipocytokine signaling pathway
Drug target
Perhexiline: 
Other: 
Class
Metabolism; Overview; Fatty acid metabolism [PATH:hsa01212]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:hsa04920]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:hsa03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 792 aa AA seqDB search
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPILSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMAARAGNAVHALLLYRHRLNRQEIPPTLLMGMRPLCSAQYEKIF
NTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSP
ACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAA
SLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATECF
QLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLF
GKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACN
FVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFL
TQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVSYIFMGDGMITF
HISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKENSRHRCGFLSRQT
GASKASMTSTDF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgctgacctcggacggggctgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgtttcctgccagccccctc
agttggcttttcctcttcagtgccatccagcttgcctggttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagttgctgcctgactggggtggacaacaccacggg
ctccggggggtcctggcagccgcgctgtttgcctcgtgtttgtggggagccctgatcttc
acactgcacgtggccctgaggctgcttctgtcctaccacggctggcttcttgagccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctctggccgc
cacccgatgctgttcagttaccagcgctccctgccacgccagcccgtgccctctgtgcag
gacaccgtgcgcaagtacctggagtcggtccggcccatcctctccgacgaggacttcgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgcggctcaagtcctggtgggcgtccaattatgtcagtgactggtgggaggaatttgtg
tacctgcgctcccgaaatccgctgatggtgaacagcaactattacatgatggcagctcgc
gctgggaatgccgtccatgccctcctcctgtaccgccaccgcctgaaccgccaggagata
cccccgactttgctgatgggaatgcgccccttatgctctgcccagtacgagaagatcttc
aacaccacgcggattccaggggtccaaaaagactacatccgccacctccatgacagccaa
cacgtggctgtcttccaccggggccgattcttccgcatggggacccactcccgaaacagc
ctgctttccccgagagccctggagcagcagtttcagagaatcctggatgatccctcaccg
gcctgcccccacgaggaacatctggcagctctgacagctgctcccaggggcacgtgggcc
caggtgcggacatccctgaagacccaggcagcggaggccctggaggcggtggaaggggcc
gctttctttgtgtcactggatgctgagcccgcggggctcaccagggaggacccggcagcg
tcgttggatgcctacgcccatgctctgctggccggccggggccatgatcgctggtttgac
aaatccttcaccctaatcgtcttctctaacgggaagctgggcctcagcgtggagcactcc
tgggccgactgccccatctcaggacacatgtgggagttcactctggctacagaatgcttt
cagctgggctactcaacagacggccactgcaaggggcacccggaccccacactaccccag
ccccagcggctgcaatgggaccttccagaccagatccactcctccatctctctagccctg
aggggagccaagatcttgtctgaaaatgtcgactgccatgtcgttccattctccctattt
ggcaagagcttcatccgacgctgccacctctcttcagacagcttcatccagatcgccttg
caactggcccacttccgggacaggggtcaattctgcctgacttatgagtcggccatgact
cgcttattcctggaaggccggacggagacggtgcggtcttgcacgagggaggcctgcaac
tttgtcagggccatggaggacaaagagaagacggacccacagtgcctcgccctgttccgc
gtggcagtggacaagcaccaggctctgctgaaggcagccatgagcgggcagggagttgac
cgccacctgtttgcgctgtacatcgtgtcccgattcctccacctgcagtcgcccttcctg
acccaggtccattcggagcagtggcagctgtccaccagccagatccctgttcagcaaatg
catctgtttgacgtccacaattacccggactatgtttcctcaggcggtggattcgggcct
gctgatgaccatggttatggtgtttcttatatcttcatgggggatggcatgatcaccttc
cacatctccagcaaaaaatcaagcacaaaaacggattcccacaggctggggcagcacatt
gaggacgcactgctggatgtggcctccctgttccaggcgggacagcattttaagcgccgg
ttcagagggtcagggaaggagaactccaggcacaggtgtggatttctctcccgccagact
ggggcctccaaggcctcaatgacatccaccgacttctga

DBGET integrated database retrieval system