KEGG   Homo sapiens (human): 126129Help
Entry
126129            CDS       T01001                                 

Gene name
CPT1C, CATL1, CPT1-B, CPT1P, CPTI-B, CPTIC
Definition
carnitine palmitoyltransferase 1C (EC:2.3.1.21)
Orthology
K08765  
carnitine O-palmitoyltransferase 1 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Drug target
Perhexiline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    126129 (CPT1C)
  Lipid metabolism
   00071 Fatty acid degradation
    126129 (CPT1C)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    126129 (CPT1C)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    126129 (CPT1C)
   03320 PPAR signaling pathway
    126129 (CPT1C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     126129 (CPT1C)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    126129 (CPT1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.33
AA seq 792 aa AA seqDB search
MAEAHQAVGFRPSLTSDGAEVELSAPVLQEIYLSGLRSWKRHLSRFWNDFLTGVFPASPL
SWLFLFSAIQLAWFLQLDPSLGLMEKIKELLPDWGGQHHGLRGVLAAALFASCLWGALIF
TLHVALRLLLSYHGWLLEPHGAMSSPTKTWLALVRIFSGRHPMLFSYQRSLPRQPVPSVQ
DTVRKYLESVRPILSDEDFDWTAVLAQEFLRLQASLLQWYLRLKSWWASNYVSDWWEEFV
YLRSRNPLMVNSNYYMMAARAGNAVHALLLYRHRLNRQEIPPTLLMGMRPLCSAQYEKIF
NTTRIPGVQKDYIRHLHDSQHVAVFHRGRFFRMGTHSRNSLLSPRALEQQFQRILDDPSP
ACPHEEHLAALTAAPRGTWAQVRTSLKTQAAEALEAVEGAAFFVSLDAEPAGLTREDPAA
SLDAYAHALLAGRGHDRWFDKSFTLIVFSNGKLGLSVEHSWADCPISGHMWEFTLATECF
QLGYSTDGHCKGHPDPTLPQPQRLQWDLPDQIHSSISLALRGAKILSENVDCHVVPFSLF
GKSFIRRCHLSSDSFIQIALQLAHFRDRGQFCLTYESAMTRLFLEGRTETVRSCTREACN
FVRAMEDKEKTDPQCLALFRVAVDKHQALLKAAMSGQGVDRHLFALYIVSRFLHLQSPFL
TQVHSEQWQLSTSQIPVQQMHLFDVHNYPDYVSSGGGFGPADDHGYGVSYIFMGDGMITF
HISSKKSSTKTDSHRLGQHIEDALLDVASLFQAGQHFKRRFRGSGKENSRHRCGFLSRQT
GASKASMTSTDF
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcgcaccaggccgtgggcttccgaccctcgctgacctcggacggggctgaa
gtggaactcagtgcccctgtgctgcaggagatctacctctctggcctgcgctcctggaaa
aggcatctctcacgtttctggaatgactttctcaccggtgtgtttcctgccagccccctc
agttggcttttcctcttcagtgccatccagcttgcctggttcctccagctggatccttcc
ttaggactgatggagaagatcaaagagttgctgcctgactggggtggacaacaccacggg
ctccggggggtcctggcagccgcgctgtttgcctcgtgtttgtggggagccctgatcttc
acactgcacgtggccctgaggctgcttctgtcctaccacggctggcttcttgagccccac
ggagccatgtcctcccccaccaagacctggctggccctggtccgcatcttctctggccgc
cacccgatgctgttcagttaccagcgctccctgccacgccagcccgtgccctctgtgcag
gacaccgtgcgcaagtacctggagtcggtccggcccatcctctccgacgaggacttcgac
tggaccgcggtcctggcgcaggaattcctgaggctgcaggcgtcgctgctgcagtggtac
ctgcggctcaagtcctggtgggcgtccaattatgtcagtgactggtgggaggaatttgtg
tacctgcgctcccgaaatccgctgatggtgaacagcaactattacatgatggcagctcgc
gctgggaatgccgtccatgccctcctcctgtaccgccaccgcctgaaccgccaggagata
cccccgactttgctgatgggaatgcgccccttatgctctgcccagtacgagaagatcttc
aacaccacgcggattccaggggtccaaaaagactacatccgccacctccatgacagccaa
cacgtggctgtcttccaccggggccgattcttccgcatggggacccactcccgaaacagc
ctgctttccccgagagccctggagcagcagtttcagagaatcctggatgatccctcaccg
gcctgcccccacgaggaacatctggcagctctgacagctgctcccaggggcacgtgggcc
caggtgcggacatccctgaagacccaggcagcggaggccctggaggcggtggaaggggcc
gctttctttgtgtcactggatgctgagcccgcggggctcaccagggaggacccggcagcg
tcgttggatgcctacgcccatgctctgctggccggccggggccatgatcgctggtttgac
aaatccttcaccctaatcgtcttctctaacgggaagctgggcctcagcgtggagcactcc
tgggccgactgccccatctcaggacacatgtgggagttcactctggctacagaatgcttt
cagctgggctactcaacagacggccactgcaaggggcacccggaccccacactaccccag
ccccagcggctgcaatgggaccttccagaccagatccactcctccatctctctagccctg
aggggagccaagatcttgtctgaaaatgtcgactgccatgtcgttccattctccctattt
ggcaagagcttcatccgacgctgccacctctcttcagacagcttcatccagatcgccttg
caactggcccacttccgggacaggggtcaattctgcctgacttatgagtcggccatgact
cgcttattcctggaaggccggacggagacggtgcggtcttgcacgagggaggcctgcaac
tttgtcagggccatggaggacaaagagaagacggacccacagtgcctcgccctgttccgc
gtggcagtggacaagcaccaggctctgctgaaggcagccatgagcgggcagggagttgac
cgccacctgtttgcgctgtacatcgtgtcccgattcctccacctgcagtcgcccttcctg
acccaggtccattcggagcagtggcagctgtccaccagccagatccctgttcagcaaatg
catctgtttgacgtccacaattacccggactatgtttcctcaggcggtggattcgggcct
gctgatgaccatggttatggtgtttcttatatcttcatgggggatggcatgatcaccttc
cacatctccagcaaaaaatcaagcacaaaaacggattcccacaggctggggcagcacatt
gaggacgcactgctggatgtggcctccctgttccaggcgggacagcattttaagcgccgg
ttcagagggtcagggaaggagaactccaggcacaggtgtggatttctctcccgccagact
ggggcctccaaggcctcaatgacatccaccgacttctga

DBGET integrated database retrieval system