KEGG   Homo sapiens (human): 1262Help
Entry
1262              CDS       T01001                                 

Gene name
CNGA4, CNCA2, CNG-4, CNG4, CNG5, CNGB2, OCNC2, OCNCBETA, OCNCb
Definition
cyclic nucleotide gated channel alpha 4
Orthology
K04951  
cyclic nucleotide gated channel alpha 4
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    1262 (CNGA4)
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    1262 (CNGA4)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Cyclic nucleotide-gated channel (CNG)
   1262 (CNGA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.4
AA seq 575 aa AA seqDB search
MSQDTKVKTTESSPPAPSKARKLLPVLDPSGDYYYWWLNTMVFPVMYNLIILVCRACFPD
LQHGYLVAWLVLDYTSDLLYLLDMVVRFHTGFLEQGILVVDKGRISSRYVRTWSFFLDLA
SLMPTDVVYVRLGPHTPTLRLNRFLRAPRLFEAFDRTETRTAYPNAFRIAKLMLYIFVVI
HWNSCLYFALSRYLGFGRDAWVYPDPAQPGFERLRRQYLYSFYFSTLILTTVGDTPPPAR
EEEYLFMVGDFLLAVMGFATIMGSMSSVIYNMNTADAAFYPDHALVKKYMKLQHVNRKLE
RRVIDWYQHLQINKKMTNEVAILQHLPERLRAEVAVSVHLSTLSRVQIFQNCEASLLEEL
VLKLQPQTYSPGEYVCRKGDIGQEMYIIREGQLAVVADDGITQYAVLGAGLYFGEISIIN
IKGNMSGNRRTANIKSLGYSDLFCLSKEDLREVLSEYPQAQTIMEEKGREILLKMNKLDV
NAEAAEIALQEATESRLRGLDQQLDDLQTKFARLLAELESSALKIAYRIERLEWQTREWP
MPEDLAEADDEGEPEEGTSKDEEGRASQEGPPGPE
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggacaccaaagtgaagacaacagagtccagtcccccagccccatccaaggcc
aggaagttgctgcctgtcctggacccatctggggattactactactggtggctgaacaca
atggtcttcccagtcatgtataacctcatcatcctcgtgtgcagagcctgcttccccgac
ttgcagcacggttatctggtggcctggttggtgctggactacacgagtgacctgctatac
ctactagacatggtggtgcgcttccacacaggattcttggaacagggcatcctggtggtg
gacaagggtaggatctcgagtcgctacgttcgcacctggagtttcttcttggacctggct
tccctgatgcccacagatgtggtctacgtgcggctgggcccgcacacacccaccctgagg
ctgaaccgctttctccgcgcgccccgcctcttcgaggccttcgaccgcacagagacccgc
acagcttacccaaatgcctttcgcattgccaagctgatgctttacatttttgtcgtcatc
cattggaacagctgcctatactttgccctatcccggtacctgggcttcgggcgtgacgca
tgggtgtacccggaccccgcgcagcctggctttgagcgcctgcggcgccagtacctctat
agcttttacttctccacgctgatactgactacagtgggcgatacaccgccgccagccagg
gaagaagagtacctcttcatggtgggcgacttcctgctggccgtcatgggtttcgccacc
atcatgggtagcatgagctctgtcatctacaacatgaacactgcagatgcggctttctac
ccagatcatgcactggtgaagaagtacatgaagctgcagcacgtcaaccgcaagctggag
cggcgagttattgactggtatcagcacctgcagatcaacaagaagatgaccaacgaggta
gccatcttacagcacttgcctgagcggctgcgggcagaagtggctgtgtctgtgcacctg
tccactctgagccgggtgcagatctttcagaactgtgaggccagcctgctggaggagctg
gtgctgaagctgcagccccagacctactcaccaggtgaatatgtatgccgcaaaggagac
attggccaagagatgtacatcatccgagagggtcaactggccgtggtggcagatgatggt
atcacacagtatgctgtgctcggtgcagggctctactttggggagatcagcatcatcaac
atcaaagggaacatgtctgggaaccgccgcacagccaacatcaagagcctaggttattca
gacctattctgcctgagcaaggaggacctgcgggaggtgctgagcgagtatccacaagca
cagaccatcatggaggagaaaggacgtgagatcctgctgaaaatgaacaagttggacgtg
aatgctgaggcagctgagatcgccctgcaggaggccacagagtcccggctacgaggccta
gaccagcagctggatgatctacagaccaagtttgctcgcctcctggctgagctggagtcc
agcgcacttaagattgcttaccgcattgaacggctggagtggcagactcgagagtggcca
atgcccgaggacctggctgaggctgatgacgagggtgagcctgaggagggaacttccaaa
gatgaagagggcagggccagccaggagggacccccaggtccagagtga

DBGET integrated database retrieval system