KEGG   Homo sapiens (human): 126370Help
Entry
126370            CDS       T01001                                 

Gene name
OR1I1, OR19-20, OR1I1P, OR1I1Q
Definition
(RefSeq) olfactory receptor family 1 subfamily I member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    126370 (OR1I1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    126370 (OR1I1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 126370
NCBI-ProteinID: NP_001004713
HGNC: 8207
Ensembl: ENSG00000094661
Vega: OTTHUMG00000183206
Pharos: O60431(Tdark)
UniProt: O60431
Position
19p13.12
AA seq 355 aa AA seqDB search
MEPEKQTEISEFFLQGLSEKPEHQTLLFTMFLSTYLVTIIGNALIILAIITDSHLHTPMY
FFLFNLSLVDTLLSSTTVPKMLANIQAQSRAIPFVGCLTQMYAFHLFGTMDSFLLAVMAI
DRFVAIVHPQRYLVLMCSPVCGLLLGASWMITNLQSLIHTCLMAQLTFCAGSEISHFFCD
LMPLLKLSGSDTHTNELVIFAFGIVVGTSPFSCILLSYIRIFWTVFKIPSTRGKWKAFST
CGLHLTVVSLSYGTIFAVYLQPTSPSSSQKDKAAALMCGVFIPMLNPFIYSIRNKDMKAA
LGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYPGGVQSLAGNRDME
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagaaaagcaaaccgaaatctcagaattcttcctccagggactctcagaaaag
ccagagcatcagaccctcctcttcacaatgttcctctccacatacctggtcaccatcatt
ggaaatgccctcattatcctggccatcatcacggactctcacctccacacacccatgtac
ttctttctcttcaacctctcactcgttgacaccctattatcctccaccaccgtccccaag
atgctagcgaacatccaggctcagagcagagccatcccctttgtgggctgcctcacccag
atgtatgccttccacctgttcgggaccatggacagctttctcctggcagtaatggccatc
gaccgcttcgtggccattgtccacccacagcgttacttggttctcatgtgctcccctgtc
tgtgggctgctgctgggagcatcatggatgatcaccaacctccagtctctcatacacacc
tgcctcatggctcaactgaccttctgcgccggctctgaaatctcccacttcttctgtgac
ctcatgcccctgctgaagctctccggctcagacacgcacaccaacgagctggtgatcttt
gcttttggcattgtcgtgggcaccagcccattctcctgcatccttctctcgtacatccgc
attttctggacagtctttaagatcccttctactcggggcaagtggaaagccttctccacc
tgtggcttacacctcactgtggtgtcactgtcctatgggaccatctttgctgtgtactta
cagcccacatcccccagctcctcccagaaggacaaggcagccgccctaatgtgtggggtg
ttcatccccatgctcaacccctttatctacagcatacggaacaaggatatgaaggcagcc
ctggggaagctcatcggcaaagtggccgtcccctgtcctaggccagaacagttattggat
gtttatcatgttccaggatcactgttggctgctagggacacagagatgcatcccatcccc
taccctggaggagttcagagtctagctgggaacagagacatggaataa

DBGET integrated database retrieval system