KEGG   Homo sapiens (human): 126410Help
Entry
126410            CDS       T01001                                 

Gene name
CYP4F22, ARCI5, INLNE, LI3
Definition
(RefSeq) cytochrome P450 family 4 subfamily F member 22
  KO
K17731  
cytochrome P450, family 4, subfamily F, polypeptide 22
Organism
hsa  Homo sapiens (human)
Disease
H00734  
Lamellar ichthyosis (LI) and Non-bullous congenital ichthyosiform erythroderma (NBCIE)
Brite
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   126410 (CYP4F22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 531 aa AA seqDB search
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFP
QPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLG
ASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSAD
IMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALS
VRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQG
KTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEK
CREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRI
IPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSF
AMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccatcacagaccgcctgctgcacctcctggggctggagaagacggcgttccgc
atatacgcggtgtccacccttctcctcttcctgctcttcttcctgttccgcctgctgctg
cggttcctgaggctctgcaggagcttctacatcacctgccgccggctgcgctgcttcccc
cagcctccccggcgcaactggctgctgggccacctgggcatgtaccttccaaatgaggcg
ggccttcaagatgagaagaaggtactggacaacatgcaccatgtactcttggtatggatg
ggacctgtcctgccgctgttggttctggtgcaccctgattacatcaaaccccttttggga
gcctcagctgccatcgcccccaaggatgacctcttctatggcttcctaaaaccttggcta
ggggatgggctgctgctcagcaaaggtgacaagtggagccggcaccgtcgcctgctgaca
cccgccttccactttgacatcctgaagccttacatgaagatcttcaaccagagcgctgac
attatgcatgctaaatggcggcatctggcagagggctcagcggtctcccttgatatgttt
gagcatatcagcctcatgaccctggacagtcttcagaaatgtgtcttcagctacaacagc
aactgccaagagaagatgagtgattatatctccgctatcattgaactgagcgctctgtct
gtccggcgccagtatcgcttgcaccactacctcgacttcatttactaccgctcggcggat
gggcggaggttccggcaggcctgtgacatggtgcaccacttcaccactgaagtcatccag
gaacggcggcgggcactgcgtcagcagggggccgaggcctggcttaaggccaagcagggg
aagaccttggactttattgatgtgctgctcctggccagggatgaagatggaaaggaactg
tcagacgaggatatccgagccgaagcagacaccttcatgtttgagggtcacgacacaaca
tccagtgggatctcttggatgctgttcaatttggcaaagtatccggaataccaggagaaa
tgccgagaagagattcaggaagtcatgaaaggccgggagctggaggagctggagtgggac
gatctgactcagctgccctttacaactatgtgcattaaggagagcctgcgccagtaccca
cctgtcactcttgtctctcgccaatgcacggaggacatcaagctcccagatgggcgcatc
atccccaaaggaatcatctgcttggtcagcatctatggaacccaccacaaccccacagtg
tggcctgactccaaggtgtacaacccctaccgctttgacccggacaacccacagcagcgc
tctccactggcctatgtgcccttctctgcaggacccaggaattgcatcggacagagcttc
gccatggccgagttgcgcgtggttgtggcactaacactgctacgtttccgcctgagcgtg
gaccgaacgcgcaaggtgcggcggaagccggagctcatactgcgcacggagaacgggctc
tggctcaaggtggagccgctgcctccgcgggcctga

DBGET integrated database retrieval system