KEGG   Homo sapiens (human): 126410Help
Entry
126410            CDS       T01001                                 

Gene name
CYP4F22, ARCI5, INLNE, LI3
Definition
cytochrome P450, family 4, subfamily F, polypeptide 22
Orthology
K17731  
cytochrome P450, family 4, subfamily F, polypeptide 22
Organism
hsa  Homo sapiens (human)
Disease
H00734  
Lamellar ichthyosis (LI) and Non-bullous congenital ichthyosiform erythroderma (NBCIE)
Brite
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP4 family
   126410 (CYP4F22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 531 aa AA seqDB search
MLPITDRLLHLLGLEKTAFRIYAVSTLLLFLLFFLFRLLLRFLRLCRSFYITCRRLRCFP
QPPRRNWLLGHLGMYLPNEAGLQDEKKVLDNMHHVLLVWMGPVLPLLVLVHPDYIKPLLG
ASAAIAPKDDLFYGFLKPWLGDGLLLSKGDKWSRHRRLLTPAFHFDILKPYMKIFNQSAD
IMHAKWRHLAEGSAVSLDMFEHISLMTLDSLQKCVFSYNSNCQEKMSDYISAIIELSALS
VRRQYRLHHYLDFIYYRSADGRRFRQACDMVHHFTTEVIQERRRALRQQGAEAWLKAKQG
KTLDFIDVLLLARDEDGKELSDEDIRAEADTFMFEGHDTTSSGISWMLFNLAKYPEYQEK
CREEIQEVMKGRELEELEWDDLTQLPFTTMCIKESLRQYPPVTLVSRQCTEDIKLPDGRI
IPKGIICLVSIYGTHHNPTVWPDSKVYNPYRFDPDNPQQRSPLAYVPFSAGPRNCIGQSF
AMAELRVVVALTLLRFRLSVDRTRKVRRKPELILRTENGLWLKVEPLPPRA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccatcacagaccgcctgctgcacctcctggggctggagaagacggcgttccgc
atatacgcggtgtccacccttctcctcttcctgctcttcttcctgttccgcctgctgctg
cggttcctgaggctctgcaggagcttctacatcacctgccgccggctgcgctgcttcccc
cagcctccccggcgcaactggctgctgggccacctgggcatgtaccttccaaatgaggcg
ggccttcaagatgagaagaaggtactggacaacatgcaccatgtactcttggtatggatg
ggacctgtcctgccgctgttggttctggtgcaccctgattacatcaaaccccttttggga
gcctcagctgccatcgcccccaaggatgacctcttctatggcttcctaaaaccttggcta
ggggatgggctgctgctcagcaaaggtgacaagtggagccggcaccgtcgcctgctgaca
cccgccttccactttgacatcctgaagccttacatgaagatcttcaaccagagcgctgac
attatgcatgctaaatggcggcatctggcagagggctcagcggtctcccttgatatgttt
gagcatatcagcctcatgaccctggacagtcttcagaaatgtgtcttcagctacaacagc
aactgccaagagaagatgagtgattatatctccgctatcattgaactgagcgctctgtct
gtccggcgccagtatcgcttgcaccactacctcgacttcatttactaccgctcggcggat
gggcggaggttccggcaggcctgtgacatggtgcaccacttcaccactgaagtcatccag
gaacggcggcgggcactgcgtcagcagggggccgaggcctggcttaaggccaagcagggg
aagaccttggactttattgatgtgctgctcctggccagggatgaagatggaaaggaactg
tcagacgaggatatccgagccgaagcagacaccttcatgtttgagggtcacgacacaaca
tccagtgggatctcttggatgctgttcaatttggcaaagtatccggaataccaggagaaa
tgccgagaagagattcaggaagtcatgaaaggccgggagctggaggagctggagtgggac
gatctgactcagctgccctttacaactatgtgcattaaggagagcctgcgccagtaccca
cctgtcactcttgtctctcgccaatgcacggaggacatcaagctcccagatgggcgcatc
atccccaaaggaatcatctgcttggtcagcatctatggaacccaccacaaccccacagtg
tggcctgactccaaggtgtacaacccctaccgctttgacccggacaacccacagcagcgc
tctccactggcctatgtgcccttctctgcaggacccaggaattgcatcggacagagcttc
gccatggccgagttgcgcgtggttgtggcactaacactgctacgtttccgcctgagcgtg
gaccgaacgcgcaaggtgcggcggaagccggagctcatactgcgcacggagaacgggctc
tggctcaaggtggagccgctgcctccgcgggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system