KEGG   Homo sapiens (human): 126541Help
Entry
126541            CDS       T01001                                 

Gene name
OR10H4, OR19-28
Definition
(RefSeq) olfactory receptor family 10 subfamily H member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    126541 (OR10H4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    126541 (OR10H4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 126541
NCBI-ProteinID: NP_001004465
HGNC: 15388
Ensembl: ENSG00000176231
Vega: OTTHUMG00000182268
Pharos: Q8NGA5(Tdark)
UniProt: Q8NGA5 A0A126GVV2
Position
19p13.12
AA seq 316 aa AA seqDB search
MPSQNYSIISEFNLFGFSAFPQHLLPILFLLYLLMFLFTLLGNLLIMATIWIEHRLHTPM
YLFLCTLSVSEILFTVAITPRMLADLLSTHHSITFVACANQMFFSFMFGFTHSFLLLVMG
YDRYVAICHPLRYNVLMSPRDCAHLVACTWAGGSVMGMMVTTIVFHLTFCGSNVIHHFFC
HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRIPSAEGRHKTF
STCVSHLTVVVTHYSFASFIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK
NAINKNFYRKFCPPSS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtcagaactatagcatcatatctgaatttaacctctttggcttctcagccttc
ccccagcacctcctgcccatcttgttcctgctgtacctcctgatgttcctgttcacattg
ctgggcaaccttctcatcatggccacaatctggattgaacacagactccacacacccatg
tacctcttcttgtgcaccctctccgtctctgagattctgttcactgttgccatcacccct
cgcatgctggctgatctgctttccacccatcattccatcacctttgtggcttgtgccaac
cagatgttcttctccttcatgtttggcttcactcactccttccttctcctggtcatgggc
tatgatcgctatgtggccatctgccacccactgcgttacaatgtgctcatgagcccccgt
gactgtgcccatcttgtggcctgtacctgggctggtggctcagtcatggggatgatggtg
acaacgatagttttccacctcactttctgtgggtctaatgtgatccaccattttttctgt
catgtgctttccctcttgaagttggcctgtgaaaacaagacatcatctgtcatcatgggt
gtgatgctggtgtgtgtcacagccctgataggctgtttattcctcatcatcctctcctat
gtcttcattgtggctgccatcttgaggattccctctgccgaaggccggcacaagacattt
tctacgtgtgtatcccacctcactgtggtggtcacgcactatagttttgcctcctttatc
tacctcaagcccaagggcctccattctatgtacagtgacgccttgatggccaccacctat
actgtcttcacccccttccttagcccaatcattttcagcctaaggaacaaggagctgaag
aatgccataaataaaaacttttacagaaaattctgtcctccaagttcctga

DBGET integrated database retrieval system