KEGG   Homo sapiens (human): 126541Help
Entry
126541            CDS       T01001                                 

Gene name
OR10H4, OR19-28
Definition
olfactory receptor, family 10, subfamily H, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.12
AA seq 316 aa AA seqDB search
MPSQNYSIISEFNLFGFSAFPQHLLPILFLLYLLMFLFTLLGNLLIMATIWIEHRLHTPM
YLFLCTLSVSEILFTVAITPRMLADLLSTHHSITFVACANQMFFSFMFGFTHSFLLLVMG
YDRYVAICHPLRYNVLMSPRDCAHLVACTWAGGSVMGMMVTTIVFHLTFCGSNVIHHFFC
HVLSLLKLACENKTSSVIMGVMLVCVTALIGCLFLIILSYVFIVAAILRIPSAEGRHKTF
STCVSHLTVVVTHYSFASFIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELK
NAINKNFYRKFCPPSS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcctagtcagaactatagcatcatatctgaatttaacctctttggcttctcagccttc
ccccagcacctcctgcccatcttgttcctgctgtacctcctgatgttcctgttcacattg
ctgggcaaccttctcatcatggccacaatctggattgaacacagactccacacacccatg
tacctcttcttgtgcaccctctccgtctctgagattctgttcactgttgccatcacccct
cgcatgctggctgatctgctttccacccatcattccatcacctttgtggcttgtgccaac
cagatgttcttctccttcatgtttggcttcactcactccttccttctcctggtcatgggc
tatgatcgctatgtggccatctgccacccactgcgttacaatgtgctcatgagcccccgt
gactgtgcccatcttgtggcctgtacctgggctggtggctcagtcatggggatgatggtg
acaacgatagttttccacctcactttctgtgggtctaatgtgatccaccattttttctgt
catgtgctttccctcttgaagttggcctgtgaaaacaagacatcatctgtcatcatgggt
gtgatgctggtgtgtgtcacagccctgataggctgtttattcctcatcatcctctcctat
gtcttcattgtggctgccatcttgaggattccctctgccgaaggccggcacaagacattt
tctacgtgtgtatcccacctcactgtggtggtcacgcactatagttttgcctcctttatc
tacctcaagcccaagggcctccattctatgtacagtgacgccttgatggccaccacctat
actgtcttcacccccttccttagcccaatcattttcagcctaaggaacaaggagctgaag
aatgccataaataaaaacttttacagaaaattctgtcctccaagttcctga

DBGET integrated database retrieval system