KEGG   Homo sapiens (human): 1268Help
Entry
1268              CDS       T01001                                 

Gene name
CNR1, CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR
Definition
cannabinoid receptor 1 (brain)
Orthology
K04277  
cannabinoid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
Drug target
Dronabinol: 
Nabilone: 
Rimonabant: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1268 (CNR1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1268 (CNR1)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    1268 (CNR1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Cannabinoid
    1268 (CNR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q14-q15
AA seq 472 aa AA seqDB search
MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgatcctagatggccttgcagataccaccttccgcaccatcaccactgacctc
ctgtacgtgggctcaaatgacattcagtacgaagacatcaaaggtgacatggcatccaaa
ttagggtacttcccacagaaattccctttaacttcctttaggggaagtcccttccaagag
aagatgactgcgggagacaacccccagctagtcccagcagaccaggtgaacattacagaa
ttttacaacaagtctctctcgtccttcaaggagaatgaggagaacatccagtgtggggag
aacttcatggacatagagtgtttcatggtcctgaaccccagccagcagctggccattgca
gtcctgtccctcacgctgggcaccttcacggtcctggagaacctcctggtgctgtgcgtc
atcctccactcccgcagcctccgctgcaggccttcctaccacttcatcggcagcctggcg
gtggcagacctcctggggagtgtcatttttgtctacagcttcattgacttccacgtgttc
caccgcaaagatagccgcaacgtgtttctgttcaaactgggtggggtcacggcctccttc
actgcctccgtgggcagcctgttcctcacagccatcgacaggtacatatccattcacagg
cccctggcctataagaggattgtcaccaggcccaaggccgtggtggcgttttgcctgatg
tggaccatagccattgtgatcgccgtgctgcctctcctgggctggaactgcgagaaactg
caatctgtttgctcagacattttcccacacattgatgaaacctacctgatgttctggatc
ggggtcaccagcgtactgcttctgttcatcgtgtatgcgtacatgtatattctctggaag
gctcacagccacgccgtccgcatgattcagcgtggcacccagaagagcatcatcatccac
acgtctgaggatgggaaggtacaggtgacccggccagaccaagcccgcatggacattagg
ttagccaagaccctggtcctgatcctggtggtgttgatcatctgctggggccctctgctt
gcaatcatggtgtatgatgtctttgggaagatgaacaagctcattaagacggtgtttgca
ttctgcagtatgctctgcctgctgaactccaccgtgaaccccatcatctatgctctgagg
agtaaggacctgcgacacgctttccggagcatgtttccctcttgtgaaggcactgcgcag
cctctggataacagcatgggggactcggactgcctgcacaaacacgcaaacaatgcagcc
agtgttcacagggccgcagaaagctgcatcaagagcacggtcaagattgccaaggtaacc
atgtctgtgtccacagacacgtctgccgaggctctgtga

DBGET integrated database retrieval system