KEGG   Homo sapiens (human): 1269Help
Entry
1269              CDS       T01001                                 

Gene name
CNR2, CB-2, CB2, CX5
Definition
(RefSeq) cannabinoid receptor 2
  KO
K04278  
cannabinoid receptor 2 (macrophage)
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Dronabinol: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1269 (CNR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Cannabinoid
    1269 (CNR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
1p36.11
AA seq 360 aa AA seqDB search
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggaggaatgctgggtgacagagatagccaatggctccaaggatggcttggattccaac
cctatgaaggattacatgatcctgagtggtccccagaagacagctgttgctgtgttgtgc
actcttctgggcctgctaagtgccctggagaacgtggctgtgctctatctgatcctgtcc
tcccaccaactccgccggaagccctcatacctgttcattggcagcttggctggggctgac
ttcctggccagtgtggtctttgcatgcagctttgtgaatttccatgttttccatggtgtg
gattccaaggctgtcttcctgctgaagattggcagcgtgactatgaccttcacagcctct
gtgggtagcctcctgctgaccgccattgaccgatacctctgcctgcgctatccaccttcc
tacaaagctctgctcacccgtggaagggcactggtgaccctgggcatcatgtgggtcctc
tcagcactagtctcctacctgcccctcatgggatggacttgctgtcccaggccctgctct
gagcttttcccactgatccccaatgactacctgctgagctggctcctgttcatcgccttc
ctcttttccggaatcatctacacctatgggcatgttctctggaaggcccatcagcatgtg
gccagcttgtctggccaccaggacaggcaggtgccaggaatggcccgaatgaggctggat
gtgaggttggccaagaccctagggctagtgttggctgtgctcctcatctgttggttccca
gtgctggccctcatggcccacagcctggccactacgctcagtgaccaggtcaagaaggcc
tttgctttctgctccatgctgtgcctcatcaactccatggtcaaccctgtcatctatgct
ctacggagtggagagatccgctcctctgcccatcactgcctggctcactggaagaagtgt
gtgaggggccttgggtcagaggcaaaagaagaagccccgagatcctcagtcaccgagaca
gaggctgatgggaaaatcactccgtggccagattccagagatctagacctctctgattgc
tga

DBGET integrated database retrieval system