KEGG   Homo sapiens (human): 127Help
Entry
127               CDS       T01001                                 

Gene name
ADH4, ADH-2, HEL-S-4
Definition
alcohol dehydrogenase 4 (class II), pi polypeptide (EC:1.1.1.1)
Orthology
K13980  
alcohol dehydrogenase 4 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Drug target
Fomepizole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    127 (ADH4)
  Lipid metabolism
   00071 Fatty acid degradation
    127 (ADH4)
  Amino acid metabolism
   00350 Tyrosine metabolism
    127 (ADH4)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    127 (ADH4)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    127 (ADH4)
   00982 Drug metabolism - cytochrome P450
    127 (ADH4)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    127 (ADH4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     127 (ADH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22
AA seq 380 aa AA seqDB search
MGTKGKVIKCKAAIAWEAGKPLCIEEVEVAPPKAHEVRIQIIATSLCHTDATVIDSKFEG
LAFPVIVGHEAAGIVESIGPGVTNVKPGDKVIPLYAPLCRKCKFCLSPLTNLCGKISNLK
SPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTVVSDINLAKIDDDANLERVCLLGC
GFSTGYGAAINNAKVTPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGIDINSEKFVKAKA
LGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSETMKAALDCTTAGWGSCTFIGV
AAGSKGLTIFPEELIIGRTINGTFFGGWKSVDSIPKLVTDYKNKKFNLDALVTHTLPFDK
ISEAFDLMNQGKSVRTILIF
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccaagggcaaagttattaaatgcaaagcagccatcgcctgggaagcaggcaag
cccctttgcattgaagaggttgaagtagctccccccaaggctcatgaagttcgcattcag
atcattgctacctccctgtgccatactgatgccactgttatcgattctaaatttgagggc
ctagctttcccagtgatcgttggccatgaggctgcaggtattgtggaaagtattgggcca
ggagtgaccaacgtcaaaccaggtgacaaagtaattccactttatgcacctctatgtaga
aaatgcaagttttgtctgagtccactcacaaatttgtgtgggaaaatcagtaatctcaaa
agtcctgctagtgatcaacaactaatggaagacaaaaccagcaggtttacctgcaaagga
aaaccagtttaccatttctttggaaccagtacattctctcagtacactgtggtgtcagat
atcaatcttgccaaaatagatgatgatgcaaatttagagagagtttgtctgcttggatgt
gggttttcaactggctatggggctgcaatcaacaatgccaaggtcacccctggttcgact
tgtgctgtctttggcctaggaggtgtgggtctttctgctgtaatgggttgtaaagcagca
ggagcttccagaatcataggtattgacatcaacagtgagaagtttgtgaaggctaaagcc
ctgggagccactgactgcctcaatcctagagacttacataaaccgatccaggaagttatc
attgaattgaccaagggaggtgtggattttgcccttgactgtgcaggtggatctgaaacc
atgaaagcagccctggactgtacaaccgcaggctggggatcatgtactttcattggagta
gctgctggtagcaaaggattgactatttttccagaggagctaataatcggccgtactata
aatggaacattctttggtggttggaaaagtgtagattctatcccaaagctggtcactgac
tataagaataagaaattcaatctggatgcactggtgacccataccctgccttttgacaaa
atcagtgaggcatttgacctaatgaaccaaggaaaaagcgtccgaacaatcctcatcttt
tga

DBGET integrated database retrieval system