KEGG   Homo sapiens (human): 127059Help
Entry
127059            CDS       T01001                                 

Gene name
OR2M5, OR2M5P
Definition
(RefSeq) olfactory receptor family 2 subfamily M member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    127059 (OR2M5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    127059 (OR2M5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 127059
NCBI-ProteinID: NP_001004690
HGNC: 19576
Ensembl: ENSG00000162727
Vega: OTTHUMG00000040447
Pharos: A3KFT3(Tdark)
UniProt: A3KFT3
Position
1q44
AA seq 312 aa AA seqDB search
MAWENQTFNSDFILLGIFNHSPTHTFLFFLVLAIFSVAFMGNSVMVLLIYLDTQLHTPMY
FLLSQLFLMDLMLICSTVPKMAFNYLSGSKSISMAGCATQIFFYVSLLGSECFLLAVMSY
DRYIAICHPLRYTNLMRPKICGLMTAFSWILGSMDAIIDAVATFSFSYCGSREIAHFFCD
FPSLLILSCNDTSIFEKVLFICCIVMIVFPVAIIIASYARVILAVIHMGSGEGRRKAFTT
CSSHLMVVGMYYGAGLFMYIRPTSDRSPMQDKLVSVFYTILTPMLNPLIYSLRNKEVTRA
LRKVLGKGKCGE
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggagaatcagaccttcaactctgacttcatcctcctgggaatcttcaatcac
agccccacccacaccttcctcttctttctggtcctggccatcttttcagtggccttcatg
ggaaactctgtcatggttctcctcatctacctggacacccagctccacacccccatgtac
ttcctcctcagtcaactgttcctcatggacctcatgctcatctgctctaccgtacccaag
atggccttcaactacttgtctggcagcaagtccatttctatggctggttgtgccacacaa
attttcttctatgtatcactgcttggctccgaatgctttctgttggctgttatgtcttat
gaccgctatattgccatttgccaccctctaagatacaccaatctcatgagacccaaaatt
tgtggacttatgactgccttctcctggatcctgggctctatggatgcaatcattgatgct
gtagcgacattttccttctcctactgtgggtctcgggaaatagcccacttcttctgtgac
ttcccttccctactaatcctctcatgcaatgacacatcaatatttgaaaaggttcttttc
atctgctgtatagtaatgattgtttttcctgttgcaatcatcatcgcttcctatgctcga
gttattctggctgtcattcacatgggatctggagagggtcgtcgcaaagcttttactacc
tgttcctctcacctcatggtggtgggaatgtactatggagcaggtttgttcatgtacata
cggcccacatctgatcgctcccctatgcaggacaagctggtgtctgtattctacaccatc
ctcactcccatgctgaatcccctcatctacagcctccgcaacaaggaggtgaccagagca
ctcaggaaagtgttaggaaagggcaagtgtggagagtga

DBGET integrated database retrieval system