KEGG   Homo sapiens (human): 127066Help
Entry
127066            CDS       T01001                                 

Gene name
OR14C36, OR5BF1
Definition
olfactory receptor, family 14, subfamily C, member 36
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    127066 (OR14C36)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    127066 (OR14C36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 312 aa AA seqDB search
MPNSTTVMEFLLMRFSDVWTLQILHSASFFMLYLVTLMGNILIVTVTTCDSSLHMPMYFF
LRNLSILDACYISVTVPTSCVNSLLDSTTISKAGCVAQVFLVVFFVYVELLFLTIMAHDR
YVAVCQPLHYPVIVNSRICIQMTLASLLSGLVYAGMHTGSTFQLPFCRSNVIHQFFCDIP
SLLKLSCSDTFSNEVMIVVSALGVGGGCFIFIIRSYIHIFSTVLGFPRGADRTKAFSTCI
PHILVVSVFLSSCSSVYLRPPAIPAATQDLILSGFYSIMPPLFNPIIYSLRNKQIKVAIK
KIMKRIFYSENV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcccaattcaaccaccgtgatggaatttctcctcatgaggttttctgatgtgtggaca
ctacagattttacattctgcatccttctttatgttgtatttggtaactctaatgggaaac
atcctcattgtgaccgtcaccacctgtgacagcagccttcacatgcccatgtacttcttc
ctcaggaatctgtctatcttggatgcctgctacatttctgttacagtccctacctcatgt
gtcaattccctactggacagcaccaccatttctaaggcgggatgtgtagctcaggtcttc
ctcgtggttttttttgtatatgtggagcttctgtttctcaccattatggctcatgaccgc
tatgtggctgtctgccagccacttcactaccctgtgatcgtgaactctcgaatctgcatc
cagatgacactggcctccctactcagtggtcttgtctatgcaggcatgcacactggcagc
acattccagctgcccttctgtcggtccaacgttattcatcaattcttctgtgacatcccc
tctctgctgaagctctcttgctctgacaccttcagcaatgaggtcatgattgttgtctct
gctctgggggtaggtggcggctgtttcatctttatcatcaggtcttacattcacatcttt
tcgaccgtgctcgggtttccaagaggagcagacagaacaaaggccttttccacctgcatc
cctcacatcctggtggtgtcagtcttcctcagttcatgctcttctgtgtacctcaggcca
cctgcgatacctgcagccacccaggatctgatcctttctggtttttattccataatgcct
cccctctttaaccctattatttacagtcttagaaataagcaaataaaggtggccatcaag
aaaatcatgaagagaattttttattcagaaaatgtgtaa

DBGET integrated database retrieval system