KEGG   Homo sapiens (human): 127068Help
Entry
127068            CDS       T01001                                 

Gene name
OR2T34
Definition
olfactory receptor, family 2, subfamily T, member 34
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 318 aa AA seqDB search
MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL
HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFHLTLAGAEVFLL
AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL
SFFCETPALLKLSCSDVSLYKMLTYLCCILMLLTPIMVISSSYTLILHLIHRMNSAAGRR
KALATCSSHMIIVLLLFGASFYTYMLRSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK
DVTRALRSMMQSRMNQEK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcagggaatcagacttctcagaatcaaacagcaagcactgatttcaccctcacg
ggactctttgctgagagcaagcatgctgccctcctctacaccgtgaccttccttcttttc
ttgatggccctcactgggaatgccctcctcatcctcctcatccactcagagccccgcctc
cacacccccatgtacttcttcatcagccagctcgcgctcatggatctcatgtacctatgc
gtgactgtgcccaagatgcttgtgggccaggtcactggagatgataccatttccccgtca
ggctgtgggatccagatgttcttccacctgaccctggctggagctgaggttttcctcctg
gctgccatggcctatgaccgatatgctgctgtttgcagacctctccattacccactgctg
atgaaccagagggtgtgccagctcctggtgtcagcctgctgggttttgggaatggttgat
ggtttgttgctcacccccattaccatgagcttccccttttgccagtctaggaaaatcctg
agttttttctgtgagactcctgccctgctgaagctctcctgctctgacgtctccctctat
aagatgctcacgtacctgtgctgcatcctcatgcttctcacccccatcatggtcatctcc
agctcatacaccctcatcctgcatctcatccacaggatgaattctgccgccggccgcagg
aaggccttggccacctgctcctcccacatgatcatagtgctgctgctcttcggtgcttcc
ttctacacctacatgctccggagttcctaccacacagctgagcaggacatgatggtgtct
gccttttacaccatcttcactcctgtgctgaaccccctcatttacagtctccgcaacaaa
gatgtcaccagggctctgaggagcatgatgcagtcaagaatgaaccaagaaaagtag

DBGET integrated database retrieval system