KEGG   Homo sapiens (human): 127068Help
Entry
127068            CDS       T01001                                 

Gene name
OR2T34
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 34
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    127068 (OR2T34)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    127068 (OR2T34)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 127068
NCBI-ProteinID: NP_001001821
HGNC: 31256
Ensembl: ENSG00000183310
Vega: OTTHUMG00000040387
Pharos: Q8NGX1(Tdark)
UniProt: Q8NGX1
Position
1q44
AA seq 318 aa AA seqDB search
MCSGNQTSQNQTASTDFTLTGLFAESKHAALLYTVTFLLFLMALTGNALLILLIHSEPRL
HTPMYFFISQLALMDLMYLCVTVPKMLVGQVTGDDTISPSGCGIQMFFHLTLAGAEVFLL
AAMAYDRYAAVCRPLHYPLLMNQRVCQLLVSACWVLGMVDGLLLTPITMSFPFCQSRKIL
SFFCETPALLKLSCSDVSLYKMLTYLCCILMLLTPIMVISSSYTLILHLIHRMNSAAGRR
KALATCSSHMIIVLLLFGASFYTYMLRSSYHTAEQDMMVSAFYTIFTPVLNPLIYSLRNK
DVTRALRSMMQSRMNQEK
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcagggaatcagacttctcagaatcaaacagcaagcactgatttcaccctcacg
ggactctttgctgagagcaagcatgctgccctcctctacaccgtgaccttccttcttttc
ttgatggccctcactgggaatgccctcctcatcctcctcatccactcagagccccgcctc
cacacccccatgtacttcttcatcagccagctcgcgctcatggatctcatgtacctatgc
gtgactgtgcccaagatgcttgtgggccaggtcactggagatgataccatttccccgtca
ggctgtgggatccagatgttcttccacctgaccctggctggagctgaggttttcctcctg
gctgccatggcctatgaccgatatgctgctgtttgcagacctctccattacccactgctg
atgaaccagagggtgtgccagctcctggtgtcagcctgctgggttttgggaatggttgat
ggtttgttgctcacccccattaccatgagcttccccttttgccagtctaggaaaatcctg
agttttttctgtgagactcctgccctgctgaagctctcctgctctgacgtctccctctat
aagatgctcacgtacctgtgctgcatcctcatgcttctcacccccatcatggtcatctcc
agctcatacaccctcatcctgcatctcatccacaggatgaattctgccgccggccgcagg
aaggccttggccacctgctcctcccacatgatcatagtgctgctgctcttcggtgcttcc
ttctacacctacatgctccggagttcctaccacacagctgagcaggacatgatggtgtct
gccttttacaccatcttcactcctgtgctgaaccccctcatttacagtctccgcaacaaa
gatgtcaccagggctctgaggagcatgatgcagtcaagaatgaaccaagaaaagtag

DBGET integrated database retrieval system