KEGG   Homo sapiens (human): 127077Help
Entry
127077            CDS       T01001                                 

Gene name
OR2T11, OR2T11Q
Definition
olfactory receptor, family 2, subfamily T, member 11
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 316 aa AA seqDB search
MTNTSSSDFTLLGLLVNSEAAGIVFTVILAVFLGAVTANLVMIFLIQVDSRLHTPMYFLL
SQLSIMDTLFICTTVPKLLADMVSKEKIISFVACGIQIFLYLTMIGSEFFLLGLMAYDCY
VAVCNPLRYPVLMNRKKCLLLAAGAWFGGSLDGFLLTPITMNVPYCGSRSINHFFCEIPA
VLKLACADTSLYETLMYICCVLMLLIPISIISTSYSLILLTIHRMPSAEGRKKAFTTCSS
HLTVVSIFYGAAFYTYVLPQSFHTPEQDKVVSAFYTIVTPMLNPLIYSLRNKDVIGAFKK
VFACCSSAQKVATSDA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacacatcatcctctgacttcaccctcctggggcttctggtgaacagtgaggct
gccgggattgtatttacagtgatccttgctgttttcttgggggccgtgactgcaaatttg
gtcatgatattcttgattcaggtggactctcgcctccacacccccatgtactttctgctc
agtcagctgtccatcatggacacccttttcatctgtaccactgtcccaaaactcctggca
gacatggtttctaaagagaagatcatttcctttgtggcctgtggcatccagatcttcctc
tacctgaccatgattggttctgagttcttcctcctgggcctcatggcctatgactgctac
gtggctgtctgtaaccctctgagatacccagtcctgatgaaccgcaagaagtgtcttttg
ctggctgctggtgcctggtttgggggctccctcgatggctttctgctcactcccatcacc
atgaatgtcccttactgtggctcccgaagtatcaaccattttttctgtgagatcccagca
gttctgaaactggcctgtgcagacacgtccttgtatgaaactctgatgtacatctgctgt
gtcctcatgttgctcatccccatctctatcatctccacttcctactccctcatcttgtta
accatccaccgcatgccctctgctgaaggtcgcaaaaaggccttcaccacttgttcctcc
cacttgactgtagttagcatcttctatggggctgccttctacacatacgtgctgccccag
tccttccacacccccgagcaggacaaagtagtgtcagccttctataccattgtcacgccc
atgcttaatcctctcatctacagcctcagaaacaaggacgtcataggggcatttaaaaag
gtatttgcatgttgctcatctgctcagaaagtagcaacaagtgatgcttag

DBGET integrated database retrieval system