KEGG   Homo sapiens (human): 1271Help
Entry
1271              CDS       T01001                                 

Gene name
CNTFR
Definition
ciliary neurotrophic factor receptor
Orthology
K05059  
ciliary neurotrophic factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    1271 (CNTFR)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1271 (CNTFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p13
AA seq 372 aa AA seqDB search
MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVN
GTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNT
YPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVS
ISVSNALGHNATAITFDEFTIVKPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPL
KFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHAT
PWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPFLVSVPITLAL
AAAAATASSLLI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcctgtcccgtgggcctgctgtgctgtgcttgccgccgccgccgcagttgtc
tacgcccagagacacagtccacaggaggcaccccatgtgcagtacgagcgcctgggctct
gacgtgacactgccatgtgggacagcaaactgggatgctgcggtgacgtggcgggtaaat
gggacagacctggcccctgacctgctcaacggctctcagctggtgctccatggcctggaa
ctgggccacagtggcctctacgcctgcttccaccgtgactcctggcacctgcgccaccaa
gtcctgctgcatgtgggcttgccgccgcgggagcctgtgctcagctgccgctccaacact
taccccaagggcttctactgcagctggcatctgcccacccccacctacattcccaacacc
ttcaatgtgactgtgctgcatggctccaaaattatggtctgtgagaaggacccagccctc
aagaaccgctgccacattcgctacatgcacctgttctccaccatcaagtacaaggtctcc
ataagtgtcagcaatgccctgggccacaatgccacagctatcacctttgacgagttcacc
attgtgaagcctgatcctccagaaaatgtggtagcccggccagtgcccagcaaccctcgc
cggctggaggtgacgtggcagaccccctcgacctggcctgaccctgagtcttttcctctc
aagttctttctgcgctaccgacccctcatcctggaccagtggcagcatgtggagctgtcc
gacggcacagcacacaccatcacagatgcctacgccgggaaggagtacattatccaggtg
gcagccaaggacaatgagattgggacatggagtgactggagcgtagccgcccacgctacg
ccctggactgaggaaccgcgacacctcaccacggaggcccaggctgcggagaccacgacc
agcaccaccagctccctggcacccccacctaccacgaagatctgtgaccctggggagctg
ggcagcggcgggggaccctcggcacccttcttggtcagcgtccccatcactctggccctg
gctgccgctgccgccactgccagcagtctcttgatctga

DBGET integrated database retrieval system