KEGG   Homo sapiens (human): 127124Help
Entry
127124            CDS       T01001                                 

Gene name
ATP6V1G3, ATP6G3, Vma10
Definition
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3 (EC:3.6.3.14)
Orthology
K02152  
V-type H+-transporting ATPase subunit G
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    127124 (ATP6V1G3)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    127124 (ATP6V1G3)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    127124 (ATP6V1G3)
  Nervous system
   04721 Synaptic vesicle cycle
    127124 (ATP6V1G3)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    127124 (ATP6V1G3)
  Infectious diseases
   05110 Vibrio cholerae infection
    127124 (ATP6V1G3)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    127124 (ATP6V1G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31.3
AA seq 118 aa AA seqDB search
MTSQSQGIHQLLQAEKRAKDKLEEAKKRKGKRLKQAKEEAMVEIDQYRMQRDKEFRLKQS
KIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgacaagccagtctcaggggatccaccagcttcttcaggcagaaaaacgggccaaggac
aagctagaggaagccaagaagagaaaaggaaagcgattgaagcaagccaaggaggaagca
atggtagaaattgaccagtacagaatgcagagagataaagagtttcgactaaaacaatct
aagataatgggctctcagaataatctctcagatgaaatagaagaacaaacactagggaag
atacaagaacttaatggacactacaataagtatatggaaagtgtgatgaaccagctcttg
agcatggtctgtgacatgaaaccagaaatccatgtgaactacagagccaccaactaa

DBGET integrated database retrieval system