KEGG   Homo sapiens (human): 1272Help
Entry
1272              CDS       T01001                                 

Gene name
CNTN1, F3, GP135, MYPCN
Definition
(RefSeq) contactin 1
  KO
K06759  
contactin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1272 (CNTN1)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Neural system
   6/5 subfamily
    NRCAM; neuronal cell adhesion molecule [KO:K06756]
     1272 (CNTN1)
    NFASC; neurofascin [KO:K06757]
     1272 (CNTN1)
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     1272 (CNTN1)
 4. Link Protein Family
  PTPRZ; receptor-type tyrosine-protein phosphatase zeta [KO:K08114]
   1272 (CNTN1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  1272 (CNTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q12
AA seq 1018 aa AA seqDB search
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPIIE
GNMEAARAVDLIPWMEYEFRVVATNTLGRGEPSIPSNRIKTDGAAPNVAPSDVGGGGGRN
RELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMSPSTAF
QVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWEHVLEKIVESY
QIRYWAAHDKEEAANRVQVTSQEYSARLENLLPDTQYFIEVGACNSAGCGPPSDMIEAFT
KKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKVLYRPDGQHDGKLYSTHKH
SIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGAPTLSPSLLGLLLPAFGILVYLEF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtggttgctggtcagtcatcttgtgataatatctattactacctgtttagca
gagtttacatggtatagaagatatggtcatggagtttctgaggaagacaaaggatttgga
ccaatttttgaagagcagccaatcaataccatttatccagaggaatcactggaaggaaaa
gtctcactcaactgtagggcacgagccagccctttcccggtttacaaatggagaatgaat
aatggggacgttgatctcacaagtgatcgatacagtatggtaggaggaaaccttgttatc
aacaaccctgacaaacagaaagatgctggaatatactactgtttagcatctaataactac
gggatggtcagaagcactgaagcaaccctgagctttggatatcttgatcctttcccacct
gaggaacgtcctgaggtcagagtaaaagaagggaaaggaatggtgcttctctgtgacccc
ccataccattttccagatgatcttagctatcgctggcttctaaatgaatttcctgtattt
atcacaatggataaacggcgatttgtgtctcagacaaatggcaatctctacattgcaaat
gttgaggcttccgacaaaggcaattattcctgctttgtttccagtccttctattacaaag
agcgtgttcagcaaattcatcccactcattccaatacctgaacgaacaacaaaaccatat
cctgctgatattgtagttcagttcaaggatgtatatgcattgatgggccaaaatgtgacc
ttagaatgttttgcacttggaaatcctgttccggatatccgatggcggaaggttctagaa
ccaatgccaagcactgctgagattagcacctctggggctgttcttaagatcttcaatatt
cagctagaagatgaaggcatctatgaatgtgaggctgagaacattagaggaaaggataaa
catcaagcaagaatttatgttcaagcattccctgagtgggtagaacacatcaatgacaca
gaggtggacataggcagtgatctctactggccttgtgtggccacaggaaagcccatccct
acaatccgatggttgaaaaatggatatgcgtatcataaaggggaattaagactgtatgat
gtgacttttgaaaatgccggaatgtatcagtgcatagctgaaaacacatatggagccatt
tatgcaaatgctgagttgaagatcttggcgttggctccaacttttgaaatgaatcctatg
aagaaaaagatcctggctgctaaaggtggaagggtgataattgaatgcaaacctaaagct
gcaccgaaaccaaagttttcatggagtaaagggacagagtggcttgtcaatagcagcaga
atactcatttgggaagatggtagcttggaaatcaacaacattacaaggaatgatggaggt
atctatacatgctttgcagaaaataacagagggaaagctaatagcactggaacccttgtt
atcacagatcctacgcgaattatattggccccaattaatgccgatatcacagttggagaa
aacgccaccatgcagtgtgctgcgtcctttgatcctgccttggatctcacatttgtttgg
tccttcaatggctatgtgatcgattttaacaaagagaatattcactaccagaggaatttt
atgctggattccaatggggaattactaatccgaaatgcgcagctgaaacatgctggaaga
tacacatgcactgcccagacaattgtggacaattcttcagcttcagctgaccttgtagtg
agaggccctccaggccctccaggtggtctgagaatagaagacattagagccacttctgtg
gcacttacttggagccgtggttcagacaatcatagtcctatttctaaatacactatccag
accaagactattctttcagatgactggaaagatgcaaagacagatcccccaattattgaa
ggaaatatggaggcagcaagagcagtggacttaatcccatggatggagtatgaattccgc
gtggtagcaaccaatacactgggtagaggagagcccagtataccatctaacagaattaaa
acagacggtgctgcaccaaatgtggctccttcagatgtaggaggtggaggtggaagaaac
agagagctgaccataacatgggcgcctttgtcaagagaataccactatggcaacaatttt
ggttacatagtggcatttaagccatttgatggagaagaatggaaaaaagtcacagttact
aatcctgatactggccgatatgtccataaagatgaaaccatgagcccttccactgcattt
caagttaaagtcaaggccttcaacaacaaaggagatggaccttacagcctagtagcagtc
attaattcagcacaagacgctcccagtgaagccccaacagaagtaggtgtaaaagtctta
tcatcttctgagatatctgttcattgggaacatgttttagaaaaaatagtggaaagctat
cagattcggtattgggctgcccatgacaaagaagaagctgcaaacagagttcaagtcacc
agccaagagtactcggccaggctcgagaaccttctgccagacacccagtattttatagaa
gtcggggcctgcaatagtgcagggtgtggacctccaagtgacatgattgaggctttcacc
aagaaagcacctcctagccagcctccaaggatcatcagttcagtaaggtctggttcacgc
tatataatcacctgggatcatgtcgttgcactatcaaatgaatctacagtgacgggatat
aaggtactctacagacctgatggccagcatgatggcaagctgtattcaactcacaaacac
tccatagaagtcccaatccccagagatggagaatacgttgtggaggttcgcgcgcacagt
gatggaggagatggagtggtgtctcaagtcaaaatttcaggtgcacccaccctatcccca
agtcttctcggcttactgctgcctgcctttggcatccttgtctacttggaattctga

DBGET integrated database retrieval system