KEGG   Homo sapiens (human): 1272Help
Entry
1272              CDS       T01001                                 

Gene name
CNTN1, F3, GP135, MYPCN
Definition
contactin 1
Orthology
K06759  
contactin 1
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1272 (CNTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q11-q12
AA seq 627 aa AA seqDB search
MKMWLLVSHLVIISITTCLAEFTWYRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTSDRYSMVGGNLVINNPDKQKDAGIYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVRVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDVYALMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGIYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFENAGMYQCIAENTYGAIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITDPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKENIHYQRNFMLDSNGELLIRNAQLKHAGRYTCTAQTIVDNSSASADLVV
RGKNRKGGEKNMVDSFLPVCASLPPTW
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtggttgctggtcagtcatcttgtgataatatctattactacctgtttagca
gagtttacatggtatagaagatatggtcatggagtttctgaggaagacaaaggatttgga
ccaatttttgaagagcagccaatcaataccatttatccagaggaatcactggaaggaaaa
gtctcactcaactgtagggcacgagccagccctttcccggtttacaaatggagaatgaat
aatggggacgttgatctcacaagtgatcgatacagtatggtaggaggaaaccttgttatc
aacaaccctgacaaacagaaagatgctggaatatactactgtttagcatctaataactac
gggatggtcagaagcactgaagcaaccctgagctttggatatcttgatcctttcccacct
gaggaacgtcctgaggtcagagtaaaagaagggaaaggaatggtgcttctctgtgacccc
ccataccattttccagatgatcttagctatcgctggcttctaaatgaatttcctgtattt
atcacaatggataaacggcgatttgtgtctcagacaaatggcaatctctacattgcaaat
gttgaggcttccgacaaaggcaattattcctgctttgtttccagtccttctattacaaag
agcgtgttcagcaaattcatcccactcattccaatacctgaacgaacaacaaaaccatat
cctgctgatattgtagttcagttcaaggatgtatatgcattgatgggccaaaatgtgacc
ttagaatgttttgcacttggaaatcctgttccggatatccgatggcggaaggttctagaa
ccaatgccaagcactgctgagattagcacctctggggctgttcttaagatcttcaatatt
cagctagaagatgaaggcatctatgaatgtgaggctgagaacattagaggaaaggataaa
catcaagcaagaatttatgttcaagcattccctgagtgggtagaacacatcaatgacaca
gaggtggacataggcagtgatctctactggccttgtgtggccacaggaaagcccatccct
acaatccgatggttgaaaaatggatatgcgtatcataaaggggaattaagactgtatgat
gtgacttttgaaaatgccggaatgtatcagtgcatagctgaaaacacatatggagccatt
tatgcaaatgctgagttgaagatcttggcgttggctccaacttttgaaatgaatcctatg
aagaaaaagatcctggctgctaaaggtggaagggtgataattgaatgcaaacctaaagct
gcaccgaaaccaaagttttcatggagtaaagggacagagtggcttgtcaatagcagcaga
atactcatttgggaagatggtagcttggaaatcaacaacattacaaggaatgatggaggt
atctatacatgctttgcagaaaataacagagggaaagctaatagcactggaacccttgtt
atcacagatcctacgcgaattatattggccccaattaatgccgatatcacagttggagaa
aacgccaccatgcagtgtgctgcgtcctttgatcctgccttggatctcacatttgtttgg
tccttcaatggctatgtgatcgattttaacaaagagaatattcactaccagaggaatttt
atgctggattccaatggggaattactaatccgaaatgcgcagctgaaacatgctggaaga
tacacatgcactgcccagacaattgtggacaattcttcagcttcagctgaccttgtagtg
agaggtaaaaacagaaaaggtggagagaaaaacatggtggattcctttctccccgtctgt
gcaagcctgcctccaacctggtga

DBGET integrated database retrieval system