KEGG   Homo sapiens (human): 127623Help
Entry
127623            CDS       T01001                                 

Gene name
OR2B11
Definition
olfactory receptor, family 2, subfamily B, member 11
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    127623 (OR2B11)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    127623 (OR2B11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 317 aa AA seqDB search
MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH
SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA
AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN
FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK
AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD
MKGALRRLLARIWRLCG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgacaaccatagcttcttaggggactcccctaaagccttcatccttctgggt
gtgtctgacaggccgtggctggaactccctctctttgtggtcctcctgctgtcctatgtg
ctggccatgttggggaacgtcgccatcatcctggcatcccgggtggatcctcaactccac
agccccatgtacatcttcctcagtcacctgtccttcctggacctctgctacaccaccacg
acagtccctcagatgctggtcaacatgggcagttcccagaagaccatcagctatggaggc
tgcactgtgcaatatgcagtcttccactggctgggatgcacggagtgcatcgtcctggcc
gccatggccctggaccgctacgtggccatctgcaagcccctgcactatgccgttctcatg
caccgtgctctctgtcagcagctcgtggctctggcctggctcagtggcttcggcaactcc
ttcgtgcaggtggtcctgacggtgcaattgccattctgcgggcggcaggtgctgaacaac
tttttctgtgaggtgccggccgtgatcaagctgtcgtgtgctgacaccgctgtgaatgac
accatactggctgtgctggtggccttcttcgtgttggtgcccctggctctcatccttctc
tcctatggctttattgcccgggcagtgctcaggatccagtcctccaagggacgacacaag
gcctttgggacgtgttcctcccacctgatgatcgtctccctcttctacctacctgcgatt
tacatgtatctgcagcccccttccagctactcccaagagcagggcaaatttatttctctc
ttctattccataatcacccccactctcaatcccttcacctacaccctgagaaataaagat
atgaagggggctctgaggagacttctggccaggatctggaggctctgtggatga

DBGET integrated database retrieval system