KEGG   Homo sapiens (human): 127623Help
Entry
127623            CDS       T01001                                 

Gene name
OR2B11
Definition
(RefSeq) olfactory receptor family 2 subfamily B member 11
  KO
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    127623 (OR2B11)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    127623 (OR2B11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q44
AA seq 317 aa AA seqDB search
MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH
SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA
AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN
FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK
AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD
MKGALRRLLARIWRLCG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgacaaccatagcttcttaggggactcccctaaagccttcatccttctgggt
gtgtctgacaggccgtggctggaactccctctctttgtggtcctcctgctgtcctatgtg
ctggccatgttggggaacgtcgccatcatcctggcatcccgggtggatcctcaactccac
agccccatgtacatcttcctcagtcacctgtccttcctggacctctgctacaccaccacg
acagtccctcagatgctggtcaacatgggcagttcccagaagaccatcagctatggaggc
tgcactgtgcaatatgcagtcttccactggctgggatgcacggagtgcatcgtcctggcc
gccatggccctggaccgctacgtggccatctgcaagcccctgcactatgccgttctcatg
caccgtgctctctgtcagcagctcgtggctctggcctggctcagtggcttcggcaactcc
ttcgtgcaggtggtcctgacggtgcaattgccattctgcgggcggcaggtgctgaacaac
tttttctgtgaggtgccggccgtgatcaagctgtcgtgtgctgacaccgctgtgaatgac
accatactggctgtgctggtggccttcttcgtgttggtgcccctggctctcatccttctc
tcctatggctttattgcccgggcagtgctcaggatccagtcctccaagggacgacacaag
gcctttgggacgtgttcctcccacctgatgatcgtctccctcttctacctacctgcgatt
tacatgtatctgcagcccccttccagctactcccaagagcagggcaaatttatttctctc
ttctattccataatcacccccactctcaatcccttcacctacaccctgagaaataaagat
atgaagggggctctgaggagacttctggccaggatctggaggctctgtggatga

DBGET integrated database retrieval system