KEGG   Homo sapiens (human): 128178Help
Entry
128178            CDS       T01001                                 

Gene name
EDARADD, ECTD11A, ECTD11B, ED3, EDA3
Definition
EDAR-associated death domain
Organism
hsa  Homo sapiens (human)
Disease
H00651  
Ectodermal dysplasia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.3
AA seq 205 aa AA seqDB search
MASPDDPLRADHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDM
KNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLD
PCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRAD
VEKVLRRWVDEEWPKRERGDPSRHF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaccggacgaccctctgcgcgcagatcatatggtaaaggaaccagtggaagac
acagaccctagcactttatcctttaatatgtcagacaaatatcccattcaagatacggaa
ctccctaaagctgaagaatgtgatacaattactttgaactgcccacgaaattcagatatg
aaaaatcagggagaagaaaatggctttccagatagcactggagatcctcttccagagatc
agcaaggacaactcctgcaaagaaaactgtacttgttcctcctgcttgctccgggccccc
accataagtgacttgctcaatgatcaggacttactagacgtgatcaggataaagctggat
ccgtgtcacccaacggtgaaaaactggaggaattttgcaagcaaatgggggatgtcctat
gacgaattgtgcttcctggagcagaggccacagagccccaccttggagttcttgctccgg
aacagtcagaggacggtgggccagctgatggagctctgcaggctctaccacagggccgac
gtggagaaggttctgcgcaggtgggtggacgaggagtggcccaagcgggagcgtggagac
ccctccaggcacttctag

DBGET integrated database retrieval system