KEGG   Homo sapiens (human): 1288Help
Entry
1288              CDS       T01001                                 

Gene name
COL4A6, CXDELq22.3, DELXq22.3, DFNX6
Definition
(RefSeq) collagen type IV alpha 6 chain
  KO
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
AGE-RAGE signaling pathway in diabetic complications
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Disease
H01640  
Uterine leiomyoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1288 (COL4A6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1288 (COL4A6)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    1288 (COL4A6)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1288 (COL4A6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1288 (COL4A6)
   05222 Small cell lung cancer
    1288 (COL4A6)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1288 (COL4A6)
  Infectious diseases
   05146 Amoebiasis
    1288 (COL4A6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1288 (COL4A6)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
     1288 (COL4A6)
   VLA-2
     1288 (COL4A6)
   VLA-3
     1288 (COL4A6)
   alpha 10 beta 1
     1288 (COL4A6)
   alpha 11 beta 1
     1288 (COL4A6)
  Beta8 integrins
   alpha V beta 8
    ITGB8; integrin beta 8 [KO:K06591]
     1288 (COL4A6)
 4. Link Protein Family
  CD44; CD44 antigen [KO:K06256]
   1288 (COL4A6)
 7. Others
  APP; amyloid beta A4 protein [KO:K04520]
   1288 (COL4A6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1288 (COL4A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 1691 aa AA seqDB search
MLINKLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGP
TGPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLD
GITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPG
PRGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGN
PGDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTI
GAAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSG
FCACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSG
PKGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGE
KGLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGITLPCIIP
GSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGLVHLPELPGFPGPRGEK
GLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQGLQGLTGHKGFLGDSG
LPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIKGKSGLPGAPGFPGISG
HPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSPGVAGLPALSGPKGEKG
SVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEKGDRGNPGPVGIPSPRR
PMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAPGLPGIIKGVSGKPGPP
GFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGLPGLKGDNGQTVEISGS
PGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVGLPGAPGFPGVAGMRGE
PGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKGTHGTPGPSITGVPGPA
GLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPGAPGISLPSLIAGQPGD
PGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKGPKGDQGIPGFSGLPGE
LGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQGDPGQTPTAEAVQVPPG
PLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLPGPPGALGDPGLPGLQG
PPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPIGMSQLWVGYSLLFVEG
QEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVSQTQ
IPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGAEGGGQSLVS
PGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFGELPVSETLKAGQLHTR
VSRCQVCMKSL
NT seq 5076 nt NT seq  +upstreamnt  +downstreamnt
atgcttataaacaagttgtggctgctcctggttacgttgtgcctgaccgaggaactggca
gcagcgggagagaagtcttatggaaagccatgtgggggccaggactgcagtgggagctgt
cagtgttttcctgagaaaggagcgagaggacgacctggaccaattggaattcaaggccca
acaggtcctcaaggattcactggctctactggtttatcgggattgaaaggagaaaggggt
ttcccaggccttctgggaccttatggaccaaaaggagataagggtcccatgggagttcct
ggctttcttggcatcaatgggattccgggccaccctggacaaccaggccccagaggccca
cctggtctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggc
tatcctgggcttctcggaccacccgggcttcctggtcagaaaggatcaaaaggtgaccct
gtccttgctccaggtagtttcaaaggaatgaagggggatcctgggctgcctggactggat
ggaatcactggcccacaaggagcacccggatttcctggagctgtaggacctgcaggacca
ccaggattacaaggtcctccagggcctcctggtcctcttggtcctgatgggaatatgggg
ctaggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcagga
cctccaccatctactggagagctggaattcatgggattccccaaagggaagaaaggatcc
aagggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggc
cttggaactactggagaaaagggagaaaagggagaaaagggaatccctggtttgccagga
cctaggggtcccatgggttcagaaggagtccaaggccctccagggcaacagggcaagaaa
gggaccctgggatttcctgggcttaatggattccaaggaattgagggtcaaaagggtgac
attggcctgccaggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaat
cctggagatcctggtgtacctggcctcccaggccttaaaggagatgaaggcatccaaggc
ctacgtggcccttctggtgtccctggattgccagcattatcaggtgtcccaggagcccta
gggcctcagggatttccagggctgaagggggaccaaggaaacccaggccgtaccacaatt
ggagcagctggcctccctggcagagatggtttgccaggcccaccaggtccaccaggccca
cctagtccagaatttgagactgaaactctacacaacaaagagtcagggttccctggtctc
cgaggagaacaaggtccaaaaggaaacctaggcctcaaaggaataaaaggagactcaggt
ttctgtgcttgtgacggtggtgttcccaacactggaccacccggggaaccaggcccacct
ggtccatggggtctcataggccttccaggccttaaaggagccagaggagatcgaggctct
gggggtgcacagggcccagcaggggctccaggcttagttgggcctctgggtccttcagga
cccaaaggaaagaagggggaaccaattctcagtacaatccaaggaatgccaggagatcgg
ggtgattctggctcccagggcttccgtggtgtaataggagaaccaggcaaggacggagta
ccaggtttaccaggtctgccaggccttccgggtgatggtggacagggcttcccaggtgaa
aaggggttacctggacttcctggtgaaaaaggccatcctggtccacctggcctcccagga
aatgggttaccaggacttcctggaccccgtgggcttcctggagataaaggcaaggatgga
ttaccgggacaacaaggccttcccggatctaagggaatcaccctgccctgtattattcct
gggtcatacggtccatcaggatttccaggcactcccggattcccaggccctaaagggtct
cgaggcctccctgggaccccaggccagcctgggtcaagtggaagtaaaggagagccaggg
agtccaggattggttcatcttcctgaattaccaggatttcctggacctcgtggggagaag
ggcttgcctgggtttcctgggctccctggaaaagatggcttgcctgggatgattggcagt
ccaggcttacctggttccaagggagccactggtgacatctttggtgctgaaaatggtgct
ccgggggaacaaggcctacaaggattaacagggcacaaaggatttcttggagactctggc
cttccaggactcaagggtgtgcacgggaagcctggcttactaggccccaaaggtgagcgg
ggcagccctgggacaccaggacaggtgggacagccaggcaccccaggatctagtggtcca
tatggcatcaagggcaaatctgggctcccaggagcaccaggcttcccaggcatctcagga
catcctggaaagaaaggaacaagaggcaagaaaggtcctcctggatcaattgtaaagaaa
gggctgccagggctaaaaggccttcctggaaatccaggcctagtaggactgaaaggaagc
ccaggctctccaggggtcgctgggttgccagccctctctggacccaagggagagaagggg
tctgttggattcgtaggttttccaggaataccaggtctgcctggtattcctggaacaaga
ggattaaaaggaattccaggatcaactggaaaaatgggaccatctggacgtgctggtact
cctggtgaaaagggagacagaggcaatccggggccagtcggaatacctagtccaagacgt
ccaatgtcaaacctttggctcaaaggagacaaaggctctcaaggctcagccggatccaat
ggatttcctgggccaagaggtgacaaaggagaggctggtcgacctggaccaccaggccta
cctggagctcctggcctcccaggcattatcaaaggagttagtggaaagccagggccccct
ggcttcatgggaatccggggcttacctggcctgaaggggtcctctgggatcacaggtttc
ccaggaatgccaggagaaagtggttcacaaggtatcagagggtcgcctggactcccagga
gcatctggtctcccaggcctgaaaggagacaacggccagacagttgaaatttccggtagc
ccaggacccaagggacagcctggcgaatctggttttaaaggcacaaaaggaagagatgga
ctaataggcaatataggcttccctggaaacaaaggtgaagatggaaaagttggtgtttct
ggagatgttggccttcctggagctccaggatttccaggagttgccggcatgagaggagaa
ccaggacttccaggttcttctggtcaccaaggggcaattgggcctctaggatcccccgga
ttaataggacccaaaggcttccctggatttcctggtttacatggactgaatgggcttccg
ggcaccaagggtacccatggcactccaggacctagtatcaccggtgtgcctgggcctgct
ggtctccctggacccaaaggagaaaaaggatatccaggaattggcatcggagctccaggg
aagccgggcctgagagggcaaaaaggtgatcgaggtttcccaggtctccagggccctgct
ggtctccccggtgccccaggcatctccttgccctcactcatagcaggacagcctggtgac
cccgggcgaccaggcctagatggagaacgaggccgcccaggccccgctggacccccaggt
ccccctgggccatcctcgaatcaaggcgacaccggagaccctggcttccctggaattcct
ggacctaaagggcctaagggagaccaaggaattccaggtttttctggcctccctggagag
ctaggactgaaaggcatgagaggtgagcctggcttcatggggactccaggcaaggttggg
ccacctggagacccaggatttcccggaatgaaggggaaggcagggccaagaggctcttct
ggcctccaaggtgatcctggacaaacaccaactgcagaagctgtccaggttcctcctgga
cccttgggtctaccagggatcgatggcatccctggcctcactggggaccctggggctcaa
ggccctgtaggcctacaaggctccaaaggtttacctggcatccccggtaaagatggcccc
agtgggctcccaggcccacctggggctcttggtgatcctggtctgcctggactgcaaggc
cctccaggatttgaaggagctccagggcagcaaggccccttcgggatgcctggaatgcct
ggccagagcatgagagtgggctacacgttggtaaagcacagccagtcggaacaggtgccc
ccgtgtcccatcgggatgagccagctgtgggtggggtacagcttactgtttgtggagggg
caagagaaagcccacaaccaggacctgggctttgctggctcctgtctgccccgcttcagc
accatgcccttcatctactgcaacatcaacgaggtgtgccactatgccaggcgcaatgat
aaatcttactggctctccactaccgcccctatccccatgatgcccgtcagccagacccag
attccccagtacatcagccgctgctctgtgtgtgaggcaccctcgcaagccattgctgtg
cacagccaggacatcaccatcccgcagtgccccctgggctggcgcagcctctggattggg
tactctttcctcatgcacactgccgctggtgccgagggtggaggccagtccctggtctca
cctggctcctgcctagaggactttcgggccactcctttcatcgaatgcagtggtgcccga
ggcacctgccactactttgcaaacaagtacagtttctggttgaccacagtggaggagagg
cagcagtttggggagttgcctgtgtctgaaacgctgaaagctgggcagctccacactcga
gtcagtcgctgccaggtgtgtatgaaaagcctgtag

DBGET integrated database retrieval system