KEGG   Homo sapiens (human): 1288Help
Entry
1288              CDS       T01001                                 

Gene name
COL4A6, CXDELq22.3, DELXq22.3, DFNX6
Definition
collagen, type IV, alpha 6
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1288 (COL4A6)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1288 (COL4A6)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    1288 (COL4A6)
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1288 (COL4A6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1288 (COL4A6)
   05222 Small cell lung cancer
    1288 (COL4A6)
  Infectious diseases
   05146 Amoebiasis
    1288 (COL4A6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   1288 (COL4A6)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1288 (COL4A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 1707 aa AA seqDB search
MHPGLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPT
GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDG
ITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP
RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNP
GDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIG
AAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGF
CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP
KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEK
GLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGK
GDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGL
VHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQ
GLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIK
GKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSP
GVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEK
GDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAP
GLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGL
PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG
LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKG
THGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPG
APGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKG
PKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG
DPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLP
GPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPI
GMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYW
LSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFL
MHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFG
ELPVSETLKAGQLHTRVSRCQVCMKSL
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacgttgtgcctgaccgaggaactggcagca
gcgggagagaagtcttatggaaagccatgtgggggccaggactgcagtgggagctgtcag
tgttttcctgagaaaggagcgagaggacgacctggaccaattggaattcaaggcccaaca
ggtcctcaaggattcactggctctactggtttatcgggattgaaaggagaaaggggtttc
ccaggccttctgggaccttatggaccaaaaggagataagggtcccatgggagttcctggc
tttcttggcatcaatgggattccgggccaccctggacaaccaggccccagaggcccacct
ggtctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggctat
cctgggcttctcggaccacccgggcttcctggtcagaaaggatcaaaaggtgaccctgtc
cttgctccaggtagtttcaaaggaatgaagggggatcctgggctgcctggactggatgga
atcactggcccacaaggagcacccggatttcctggagctgtaggacctgcaggaccacca
ggattacaaggtcctccagggcctcctggtcctcttggtcctgatgggaatatggggcta
ggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcaggacct
ccaccatctactggagagctggaattcatgggattccccaaagggaagaaaggatccaag
ggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggcctt
ggaactactggagaaaagggagaaaagggagaaaagggaatccctggtttgccaggacct
aggggtcccatgggttcagaaggagtccaaggccctccagggcaacagggcaagaaaggg
accctgggatttcctgggcttaatggattccaaggaattgagggtcaaaagggtgacatt
ggcctgccaggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaatcct
ggagatcctggtgtacctggcctcccaggccttaaaggagatgaaggcatccaaggccta
cgtggcccttctggtgtccctggattgccagcattatcaggtgtcccaggagccctaggg
cctcagggatttccagggctgaagggggaccaaggaaacccaggccgtaccacaattgga
gcagctggcctccctggcagagatggtttgccaggcccaccaggtccaccaggcccacct
agtccagaatttgagactgaaactctacacaacaaagagtcagggttccctggtctccga
ggagaacaaggtccaaaaggaaacctaggcctcaaaggaataaaaggagactcaggtttc
tgtgcttgtgacggtggtgttcccaacactggaccacccggggaaccaggcccacctggt
ccatggggtctcataggccttccaggccttaaaggagccagaggagatcgaggctctggg
ggtgcacagggcccagcaggggctccaggcttagttgggcctctgggtccttcaggaccc
aaaggaaagaagggggaaccaattctcagtacaatccaaggaatgccaggagatcggggt
gattctggctcccagggcttccgtggtgtaataggagaaccaggcaaggacggagtacca
ggtttaccaggtctgccaggccttccgggtgatggtggacagggcttcccaggtgaaaag
gggttacctggacttcctggtgaaaaaggccatcctggtccacctggcctcccaggaaat
gggttaccaggacttcctggaccccgtgggcttcctggagataaaggcaaggatggatta
ccgggacaacaaggccttcccggatctaagggtgactgctgctgtagagaggttggtaaa
ggagacttagacacagagagaggaatcaccctgccctgtattattcctgggtcatacggt
ccatcaggatttccaggcactcccggattcccaggccctaaagggtctcgaggcctccct
gggaccccaggccagcctgggtcaagtggaagtaaaggagagccagggagtccaggattg
gttcatcttcctgaattaccaggatttcctggacctcgtggggagaagggcttgcctggg
tttcctgggctccctggaaaagatggcttgcctgggatgattggcagtccaggcttacct
ggttccaagggagccactggtgacatctttggtgctgaaaatggtgctccgggggaacaa
ggcctacaaggattaacagggcacaaaggatttcttggagactctggccttccaggactc
aagggtgtgcacgggaagcctggcttactaggccccaaaggtgagcggggcagccctggg
acaccaggacaggtgggacagccaggcaccccaggatctagtggtccatatggcatcaag
ggcaaatctgggctcccaggagcaccaggcttcccaggcatctcaggacatcctggaaag
aaaggaacaagaggcaagaaaggtcctcctggatcaattgtaaagaaagggctgccaggg
ctaaaaggccttcctggaaatccaggcctagtaggactgaaaggaagcccaggctctcca
ggggtcgctgggttgccagccctctctggacccaagggagagaaggggtctgttggattc
gtaggttttccaggaataccaggtctgcctggtattcctggaacaagaggattaaaagga
attccaggatcaactggaaaaatgggaccatctggacgtgctggtactcctggtgaaaag
ggagacagaggcaatccggggccagtcggaatacctagtccaagacgtccaatgtcaaac
ctttggctcaaaggagacaaaggctctcaaggctcagccggatccaatggatttcctggg
ccaagaggtgacaaaggagaggctggtcgacctggaccaccaggcctacctggagctcct
ggcctcccaggcattatcaaaggagttagtggaaagccagggccccctggcttcatggga
atccggggcttacctggcctgaaggggtcctctgggatcacaggtttcccaggaatgcca
ggagaaagtggttcacaaggtatcagagggtcgcctggactcccaggagcatctggtctc
ccaggcctgaaaggagacaacggccagacagttgaaatttccggtagcccaggacccaag
ggacagcctggcgaatctggttttaaaggcacaaaaggaagagatggactaataggcaat
ataggcttccctggaaacaaaggtgaagatggaaaagttggtgtttctggagatgttggc
cttcctggagctccaggatttccaggagttgccggcatgagaggagaaccaggacttcca
ggttcttctggtcaccaaggggcaattgggcctctaggatcccccggattaataggaccc
aaaggcttccctggatttcctggtttacatggactgaatgggcttccgggcaccaagggt
acccatggcactccaggacctagtatcaccggtgtgcctgggcctgctggtctccctgga
cccaaaggagaaaaaggatatccaggaattggcatcggagctccagggaagccgggcctg
agagggcaaaaaggtgatcgaggtttcccaggtctccagggccctgctggtctccccggt
gccccaggcatctccttgccctcactcatagcaggacagcctggtgaccccgggcgacca
ggcctagatggagaacgaggccgcccaggccccgctggacccccaggtccccctgggcca
tcctcgaatcaaggcgacaccggagaccctggcttccctggaattcctggacctaaaggg
cctaagggagaccaaggaattccaggtttttctggcctccctggagagctaggactgaaa
ggcatgagaggtgagcctggcttcatggggactccaggcaaggttgggccacctggagac
ccaggatttcccggaatgaaggggaaggcagggccaagaggctcttctggcctccaaggt
gatcctggacaaacaccaactgcagaagctgtccaggttcctcctggacccttgggtcta
ccagggatcgatggcatccctggcctcactggggaccctggggctcaaggccctgtaggc
ctacaaggctccaaaggtttacctggcatccccggtaaagatggccccagtgggctccca
ggcccacctggggctcttggtgatcctggtctgcctggactgcaaggccctccaggattt
gaaggagctccagggcagcaaggccccttcgggatgcctggaatgcctggccagagcatg
agagtgggctacacgttggtaaagcacagccagtcggaacaggtgcccccgtgtcccatc
gggatgagccagctgtgggtggggtacagcttactgtttgtggaggggcaagagaaagcc
cacaaccaggacctgggctttgctggctcctgtctgccccgcttcagcaccatgcccttc
atctactgcaacatcaacgaggtgtgccactatgccaggcgcaatgataaatcttactgg
ctctccactaccgcccctatccccatgatgcccgtcagccagacccagattccccagtac
atcagccgctgctctgtgtgtgaggcaccctcgcaagccattgctgtgcacagccaggac
atcaccatcccgcagtgccccctgggctggcgcagcctctggattgggtactctttcctc
atgcacactgccgctggtgccgagggtggaggccagtccctggtctcacctggctcctgc
ctagaggactttcgggccactcctttcatcgaatgcagtggtgcccgaggcacctgccac
tactttgcaaacaagtacagtttctggttgaccacagtggaggagaggcagcagtttggg
gagttgcctgtgtctgaaacgctgaaagctgggcagctccacactcgagtcagtcgctgc
caggtgtgtatgaaaagcctgtag

DBGET integrated database retrieval system