KEGG   Homo sapiens (human): 1288Help
Entry
1288              CDS       T01001                                 

Gene name
COL4A6, CXDELq22.3, DELXq22.3
Definition
collagen, type IV, alpha 6
Orthology
K06237  
collagen, type IV, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Protein digestion and absorption
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:hsa05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22
AA seq 1707 aa AA seqDB search
MHPGLWLLLVTLCLTEELAAAGEKSYGKPCGGQDCSGSCQCFPEKGARGRPGPIGIQGPT
GPQGFTGSTGLSGLKGERGFPGLLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGPP
GLDGCNGTQGAVGFPGPDGYPGLLGPPGLPGQKGSKGDPVLAPGSFKGMKGDPGLPGLDG
ITGPQGAPGFPGAVGPAGPPGLQGPPGPPGPLGPDGNMGLGFQGEKGVKGDVGLPGPAGP
PPSTGELEFMGFPKGKKGSKGEPGPKGFPGISGPPGFPGLGTTGEKGEKGEKGIPGLPGP
RGPMGSEGVQGPPGQQGKKGTLGFPGLNGFQGIEGQKGDIGLPGPDVFIDIDGAVISGNP
GDPGVPGLPGLKGDEGIQGLRGPSGVPGLPALSGVPGALGPQGFPGLKGDQGNPGRTTIG
AAGLPGRDGLPGPPGPPGPPSPEFETETLHNKESGFPGLRGEQGPKGNLGLKGIKGDSGF
CACDGGVPNTGPPGEPGPPGPWGLIGLPGLKGARGDRGSGGAQGPAGAPGLVGPLGPSGP
KGKKGEPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGVPGLPGLPGLPGDGGQGFPGEK
GLPGLPGEKGHPGPPGLPGNGLPGLPGPRGLPGDKGKDGLPGQQGLPGSKGDCCCREVGK
GDLDTERGITLPCIIPGSYGPSGFPGTPGFPGPKGSRGLPGTPGQPGSSGSKGEPGSPGL
VHLPELPGFPGPRGEKGLPGFPGLPGKDGLPGMIGSPGLPGSKGATGDIFGAENGAPGEQ
GLQGLTGHKGFLGDSGLPGLKGVHGKPGLLGPKGERGSPGTPGQVGQPGTPGSSGPYGIK
GKSGLPGAPGFPGISGHPGKKGTRGKKGPPGSIVKKGLPGLKGLPGNPGLVGLKGSPGSP
GVAGLPALSGPKGEKGSVGFVGFPGIPGLPGIPGTRGLKGIPGSTGKMGPSGRAGTPGEK
GDRGNPGPVGIPSPRRPMSNLWLKGDKGSQGSAGSNGFPGPRGDKGEAGRPGPPGLPGAP
GLPGIIKGVSGKPGPPGFMGIRGLPGLKGSSGITGFPGMPGESGSQGIRGSPGLPGASGL
PGLKGDNGQTVEISGSPGPKGQPGESGFKGTKGRDGLIGNIGFPGNKGEDGKVGVSGDVG
LPGAPGFPGVAGMRGEPGLPGSSGHQGAIGPLGSPGLIGPKGFPGFPGLHGLNGLPGTKG
THGTPGPSITGVPGPAGLPGPKGEKGYPGIGIGAPGKPGLRGQKGDRGFPGLQGPAGLPG
APGISLPSLIAGQPGDPGRPGLDGERGRPGPAGPPGPPGPSSNQGDTGDPGFPGIPGPKG
PKGDQGIPGFSGLPGELGLKGMRGEPGFMGTPGKVGPPGDPGFPGMKGKAGPRGSSGLQG
DPGQTPTAEAVQVPPGPLGLPGIDGIPGLTGDPGAQGPVGLQGSKGLPGIPGKDGPSGLP
GPPGALGDPGLPGLQGPPGFEGAPGQQGPFGMPGMPGQSMRVGYTLVKHSQSEQVPPCPI
GMSQLWVGYSLLFVEGQEKAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYW
LSTTAPIPMMPVSQTQIPQYISRCSVCEAPSQAIAVHSQDITIPQCPLGWRSLWIGYSFL
MHTAAGAEGGGQSLVSPGSCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFG
ELPVSETLKAGQLHTRVSRCQVCMKSL
NT seq 5124 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacgttgtgcctgaccgaggaactggcagca
gcgggagagaagtcttatggaaagccatgtgggggccaggactgcagtgggagctgtcag
tgttttcctgagaaaggagcgagaggacgacctggaccaattggaattcaaggcccaaca
ggtcctcaaggattcactggctctactggtttatcgggattgaaaggagaaaggggtttc
ccaggccttctgggaccttatggaccaaaaggagataagggtcccatgggagttcctggc
tttcttggcatcaatgggattccgggccaccctggacaaccaggccccagaggcccacct
ggtctggatggctgtaatggaactcaaggagctgttggatttccaggccctgatggctat
cctgggcttctcggaccacccgggcttcctggtcagaaaggatcaaaaggtgaccctgtc
cttgctccaggtagtttcaaaggaatgaagggggatcctgggctgcctggactggatgga
atcactggcccacaaggagcacccggatttcctggagctgtaggacctgcaggaccacca
ggattacaaggtcctccagggcctcctggtcctcttggtcctgatgggaatatggggcta
ggttttcaaggagagaaaggagtcaagggggatgttggcctccctggcccagcaggacct
ccaccatctactggagagctggaattcatgggattccccaaagggaagaaaggatccaag
ggtgaaccagggcctaagggttttccaggcataagtggccctccaggcttcccgggcctt
ggaactactggagaaaagggagaaaagggagaaaagggaatccctggtttgccaggacct
aggggtcccatgggttcagaaggagtccaaggccctccagggcaacagggcaagaaaggg
accctgggatttcctgggcttaatggattccaaggaattgagggtcaaaagggtgacatt
ggcctgccaggcccagatgttttcatcgatatagatggtgctgtgatctcaggtaatcct
ggagatcctggtgtacctggcctcccaggccttaaaggagatgaaggcatccaaggccta
cgtggcccttctggtgtccctggattgccagcattatcaggtgtcccaggagccctaggg
cctcagggatttccagggctgaagggggaccaaggaaacccaggccgtaccacaattgga
gcagctggcctccctggcagagatggtttgccaggcccaccaggtccaccaggcccacct
agtccagaatttgagactgaaactctacacaacaaagagtcagggttccctggtctccga
ggagaacaaggtccaaaaggaaacctaggcctcaaaggaataaaaggagactcaggtttc
tgtgcttgtgacggtggtgttcccaacactggaccacccggggaaccaggcccacctggt
ccatggggtctcataggccttccaggccttaaaggagccagaggagatcgaggctctggg
ggtgcacagggcccagcaggggctccaggcttagttgggcctctgggtccttcaggaccc
aaaggaaagaagggggaaccaattctcagtacaatccaaggaatgccaggagatcggggt
gattctggctcccagggcttccgtggtgtaataggagaaccaggcaaggacggagtacca
ggtttaccaggtctgccaggccttccgggtgatggtggacagggcttcccaggtgaaaag
gggttacctggacttcctggtgaaaaaggccatcctggtccacctggcctcccaggaaat
gggttaccaggacttcctggaccccgtgggcttcctggagataaaggcaaggatggatta
ccgggacaacaaggccttcccggatctaagggtgactgctgctgtagagaggttggtaaa
ggagacttagacacagagagaggaatcaccctgccctgtattattcctgggtcatacggt
ccatcaggatttccaggcactcccggattcccaggccctaaagggtctcgaggcctccct
gggaccccaggccagcctgggtcaagtggaagtaaaggagagccagggagtccaggattg
gttcatcttcctgaattaccaggatttcctggacctcgtggggagaagggcttgcctggg
tttcctgggctccctggaaaagatggcttgcctgggatgattggcagtccaggcttacct
ggttccaagggagccactggtgacatctttggtgctgaaaatggtgctccgggggaacaa
ggcctacaaggattaacagggcacaaaggatttcttggagactctggccttccaggactc
aagggtgtgcacgggaagcctggcttactaggccccaaaggtgagcggggcagccctggg
acaccaggacaggtgggacagccaggcaccccaggatctagtggtccatatggcatcaag
ggcaaatctgggctcccaggagcaccaggcttcccaggcatctcaggacatcctggaaag
aaaggaacaagaggcaagaaaggtcctcctggatcaattgtaaagaaagggctgccaggg
ctaaaaggccttcctggaaatccaggcctagtaggactgaaaggaagcccaggctctcca
ggggtcgctgggttgccagccctctctggacccaagggagagaaggggtctgttggattc
gtaggttttccaggaataccaggtctgcctggtattcctggaacaagaggattaaaagga
attccaggatcaactggaaaaatgggaccatctggacgtgctggtactcctggtgaaaag
ggagacagaggcaatccggggccagtcggaatacctagtccaagacgtccaatgtcaaac
ctttggctcaaaggagacaaaggctctcaaggctcagccggatccaatggatttcctggg
ccaagaggtgacaaaggagaggctggtcgacctggaccaccaggcctacctggagctcct
ggcctcccaggcattatcaaaggagttagtggaaagccagggccccctggcttcatggga
atccggggcttacctggcctgaaggggtcctctgggatcacaggtttcccaggaatgcca
ggagaaagtggttcacaaggtatcagagggtcgcctggactcccaggagcatctggtctc
ccaggcctgaaaggagacaacggccagacagttgaaatttccggtagcccaggacccaag
ggacagcctggcgaatctggttttaaaggcacaaaaggaagagatggactaataggcaat
ataggcttccctggaaacaaaggtgaagatggaaaagttggtgtttctggagatgttggc
cttcctggagctccaggatttccaggagttgccggcatgagaggagaaccaggacttcca
ggttcttctggtcaccaaggggcaattgggcctctaggatcccccggattaataggaccc
aaaggcttccctggatttcctggtttacatggactgaatgggcttccgggcaccaagggt
acccatggcactccaggacctagtatcaccggtgtgcctgggcctgctggtctccctgga
cccaaaggagaaaaaggatatccaggaattggcatcggagctccagggaagccgggcctg
agagggcaaaaaggtgatcgaggtttcccaggtctccagggccctgctggtctccccggt
gccccaggcatctccttgccctcactcatagcaggacagcctggtgaccccgggcgacca
ggcctagatggagaacgaggccgcccaggccccgctggacccccaggtccccctgggcca
tcctcgaatcaaggcgacaccggagaccctggcttccctggaattcctggacctaaaggg
cctaagggagaccaaggaattccaggtttttctggcctccctggagagctaggactgaaa
ggcatgagaggtgagcctggcttcatggggactccaggcaaggttgggccacctggagac
ccaggatttcccggaatgaaggggaaggcagggccaagaggctcttctggcctccaaggt
gatcctggacaaacaccaactgcagaagctgtccaggttcctcctggacccttgggtcta
ccagggatcgatggcatccctggcctcactggggaccctggggctcaaggccctgtaggc
ctacaaggctccaaaggtttacctggcatccccggtaaagatggccccagtgggctccca
ggcccacctggggctcttggtgatcctggtctgcctggactgcaaggccctccaggattt
gaaggagctccagggcagcaaggccccttcgggatgcctggaatgcctggccagagcatg
agagtgggctacacgttggtaaagcacagccagtcggaacaggtgcccccgtgtcccatc
gggatgagccagctgtgggtggggtacagcttactgtttgtggaggggcaagagaaagcc
cacaaccaggacctgggctttgctggctcctgtctgccccgcttcagcaccatgcccttc
atctactgcaacatcaacgaggtgtgccactatgccaggcgcaatgataaatcttactgg
ctctccactaccgcccctatccccatgatgcccgtcagccagacccagattccccagtac
atcagccgctgctctgtgtgtgaggcaccctcgcaagccattgctgtgcacagccaggac
atcaccatcccgcagtgccccctgggctggcgcagcctctggattgggtactctttcctc
atgcacactgccgctggtgccgagggtggaggccagtccctggtctcacctggctcctgc
ctagaggactttcgggccactcctttcatcgaatgcagtggtgcccgaggcacctgccac
tactttgcaaacaagtacagtttctggttgaccacagtggaggagaggcagcagtttggg
gagttgcctgtgtctgaaacgctgaaagctgggcagctccacactcgagtcagtcgctgc
caggtgtgtatgaaaagcctgtag

DBGET integrated database retrieval system