KEGG   Homo sapiens (human): 1290Help
Entry
1290              CDS       T01001                                 

Gene name
COL5A2, EDSC
Definition
(RefSeq) collagen type V alpha 2
  KO
K19721  
collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1290 (COL5A2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1290 (COL5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q14-q32
AA seq 1499 aa AA seqDB search
MMANWAEARPLLILIVLLGQFVSIKAQEEDEDEGYGEEIACTQNGQMYLNRDIWKPAPCQ
ICVCDNGAILCDKIECQDVLDCADPVTPPGECCPVCSQTPGGGNTNFGRGRKGQKGEPGL
VPVVTGIRGRPGPAGPPGSQGPRGERGPKGRPGPRGPQGIDGEPGVPGQPGAPGPPGHPS
HPGPDGLSRPFSAQMAGLDEKSGLGSQVGLMPGSVGPVGPRGPQGLQGQQGGAGPTGPPG
EPGDPGPMGPIGSRGPEGPPGKPGEDGEPGRNGNPGEVGFAGSPGARGFPGAPGLPGLKG
HRGHKGLEGPKGEVGAPGSKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGQRGAHG
MPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPVGSPGLPG
AIGTDGTPGAKGPTGSPGTSGPPGSAGPPGSPGPQGSTGPQGIRGQPGDPGVPGFKGEAG
PKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPVGERGAPGNRGFPGSDGLPGPKG
AQGERGPVGSSGPKGSQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPG
PPGSIGIRGQPGSMGLPGPKGSSGDPGKPGEAGNAGVPGQRGAPGKDGEVGPSGPVGPPG
LAGERGEQGPPGPTGFQGLPGPPGPPGEGGKPGDQGVPGDPGAVGPLGPRGERGNPGERG
EPGITGLPGEKGMAGGHGPDGPKGSPGPSGTPGDTGPPGLQGMPGERGIAGTPGPKGDRG
GIGEKGAEGTAGNDGARGLPGPLGPPGPAGPTGEKGEPGPRGLVGPPGSRGNPGSRGENG
PTGAVGFAGPQGPDGQPGVKGEPGEPGQKGDAGSPGPQGLAGSPGPHGPNGVPGLKGGRG
TQGPPGATGFPGSAGRVGPPGPAGAPGPAGPLGEPGKEGPPGLRGDPGSHGRVGDRGPAG
PPGGPGDKGDPGEDGQPGPDGPPGPAGTTGQRGIVGMPGQRGERGMPGLPGPAGTPGKVG
PTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPG
SQGAPGTPGPVGAPGDAGQRGDPGSRGPIGPPGRAGKRGLPGPQGPRGDKGDHGDRGDRG
QKGHRGFTGLQGLPGPPGPNGEQGSAGIPGPFGPRGPPGPVGPSGKEGNPGPLGPIGPPG
VRGSVGEAGPEGPPGEPGPPGPPGPPGHLTAALGDIMGHYDESMPDPLPEFTEDQAAPDD
KNKTDPGVHATLKSLSSQIETMRSPDGSKKHPARTCDDLKLCHSAKQSGEYWIDPNQGSV
EDAIKVYCNMETGETCISANPSSVPRKTWWASKSPDNKPVWYGLDMNRGSQFAYGDHQSP
NTAITQMTFLRLLSKEASQNITYICKNSVGYMDDQAKNLKKAVVLKGANDLDIKAEGNIR
FRYIVLQDTCSKRNGNVGKTVFEYRTQNVARLPIIDLAPVDVGGTDQEFGVEIGPVCFV
NT seq 4500 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaactgggcggaagcaagacctctcctcattcttattgttttattagggcaa
tttgtctcaataaaagcccaggaagaagacgaggatgaaggatatggtgaagaaatagcc
tgcactcagaatggccagatgtacttaaacagggacatttggaaacctgccccttgtcag
atctgtgtctgtgacaatggagccattctctgtgacaagatagaatgccaggatgtgctg
gactgtgccgaccctgtaacgccccctggggaatgctgtcctgtctgttcacaaacacct
ggaggtggcaatacaaattttggtagaggaagaaagggacaaaagggagaaccaggatta
gtgcctgttgtaacaggcatacgtggtcgtccaggaccggcaggacctccaggatcacag
ggaccaagaggagagcgagggccaaaaggaagacctggccctcgtggacctcagggaatt
gatggagaaccaggtgttcctggtcaacctggtgctccaggacctcctggacatccgtcc
cacccaggacccgatggcttgagcaggccgttttcagctcaaatggctgggttggatgaa
aaatctggacttgggagtcaagtaggactaatgcctggctctgtgggtcctgttggccca
aggggaccacagggtttacaaggacagcaaggtggtgcaggacctacaggacctcctggt
gaacctggtgatcctggaccaatgggtccgattggttcacgtggaccagagggccctcct
ggtaaacctggggaagatggtgaacctggcagaaatggaaatcctggtgaagtgggattt
gcaggatctccgggagctcgtggatttcctggggctcctggtcttccaggtctgaagggt
caccgaggacacaaaggtcttgaaggccctaaaggtgaagttggagcacctggttccaag
ggtgaagctggccccactggtccaatgggtgccatgggtcctctgggtccgaggggaatg
ccaggagagagagggagacttgggccacagggtgctcctggacaacgaggtgcacatggt
atgcctggaaaacctggaccaatgggtcctcttgggataccaggctcttctggttttcca
ggaaatcctggaatgaagggagaagcaggtcctacaggggcgcgaggccctgaaggtcct
caggggcagagaggtgaaactgggcccccaggtccagttggctctccaggtcttcctggt
gcaataggaactgatggtactcctggtgccaaaggcccaacgggctctccgggtacctct
ggtcctcctggctcagcagggcctcctggatctccaggacctcagggtagcactggtcct
cagggaattcgaggccaaccgggtgatccaggagttccaggtttcaaaggagaagctggc
ccaaaaggggaaccagggccacatggtattcagggtccgataggcccacccggtgaagaa
ggcaaaagaggtcccagaggtgacccaggaacagttggtcctccagggccagtgggagaa
aggggtgctcctggcaatcgtggttttccaggctctgatggtttacctgggccaaagggt
gctcaaggagaacggggtcctgtaggttcttcaggacccaaaggaagccagggggatcca
ggacgtccaggggaacctgggcttccaggtgctcggggtttgacaggaaatcctggtgtt
caaggtcctgaaggaaaacttggacctttgggtgcgccaggggaagatggccgtccaggt
cctccaggctccataggaatcagagggcagcccgggagcatgggccttccaggccccaaa
ggtagcagtggtgaccctgggaaacctggagaagcaggaaatgctggagttcctgggcag
aggggagctcctggaaaagatggtgaagttggtccttctggtcctgtgggcccgccgggt
ctagctggtgaaagaggagaacaaggacctccaggccccacaggttttcaggggcttcct
ggtcctccagggcctcctggagaaggtggaaaaccaggtgatcaaggtgttcctggagat
cccggagcagttggcccgttaggacctagaggagaacgaggaaatcctggggaaagagga
gaacctgggataactggactccctggtgagaagggaatggctggaggacatggtcctgat
ggcccaaaaggcagtccaggtccatctgggacccctggagatacaggcccaccaggtctt
caaggtatgccgggagaaagaggaattgcaggaactcctggccccaagggtgacagaggt
ggcataggagaaaaaggtgctgaaggcacagctggaaatgatggtgcaagaggtcttcca
ggtcctttgggccctccaggtccggcaggtcctactggagaaaagggtgaacctggtcct
cgaggtttagttggccctcctggctcccggggcaatcctggttctcgaggtgaaaatggg
ccaactggagctgttggttttgccggaccccagggtcctgacggacagcctggagtaaaa
ggtgaacctggagagccaggacagaagggagatgctggttctcctggaccacaaggttta
gcaggatcccctggccctcatggtcctaatggtgttcctggactaaaaggtggtcgagga
acccaaggtccgcctggtgctacaggatttcctggttctgcgggcagagttggacctcca
ggccctgctggagctccaggacctgcgggacccctaggggaacccgggaaggagggacct
ccaggtcttcgtggggaccctggctctcatgggcgtgtgggagatcgaggaccagctggc
ccccctggtggcccaggagacaaaggggacccaggagaagatgggcaacctggtccagat
ggcccccctggtccagctggaacgaccgggcagagaggaattgttggcatgcctgggcaa
cgtggagagagaggcatgcccggcctaccaggcccagcgggaacaccaggaaaagtagga
ccaactggtgcaacaggagataaaggtccacctggacctgtggggcccccaggctccaat
ggtcctgtaggggaacctggaccagaaggtccagctggcaatgatggtaccccaggacgg
gatggtgctgttggagaacgtggtgatcgtggagaccctgggcctgcaggtctgccaggc
tctcagggtgcccctggaactcctggccctgtgggtgctccaggagatgcaggacaaaga
ggagatccgggttctcggggtcctataggaccacctggtcgagctgggaaacgtggatta
cctggaccccaaggacctcgtggtgacaaaggtgatcatggagaccgaggcgacagaggt
cagaagggccacagaggctttactggtcttcagggtcttcctggccctcctggtccaaat
ggtgaacaaggaagtgctggaatccctggaccatttggcccaagaggtcctccaggccca
gttggtccttcaggtaaagaaggaaaccctgggccacttgggccaattggacctccaggt
gtacgaggcagtgtaggagaagcaggacctgagggccctcctggtgagcctggcccacct
ggccctccgggtccccctggccaccttacagctgctcttggggatatcatggggcactat
gatgaaagcatgccagatccacttcctgagtttactgaagatcaggcggctcctgatgac
aaaaacaaaacggacccaggggttcatgctaccctgaagtcactcagtagtcagattgaa
accatgcgcagccccgatggctcgaaaaagcacccagcccgcacgtgtgatgacctaaag
ctttgccattccgcaaagcagagtggtgaatactggattgatcctaaccaaggatctgtt
gaagatgcaatcaaagtttactgcaacatggaaacaggagaaacatgtatttcagcaaac
ccatccagtgtaccacgtaaaacctggtgggccagtaaatctcctgacaataaacctgtt
tggtatggtcttgatatgaacagagggtctcagttcgcttatggagaccaccaatcacct
aatacagccattactcagatgacttttttgcgccttttatcaaaagaagcctcccagaac
atcacttacatctgtaaaaacagtgtaggatacatggacgatcaagctaagaacctcaaa
aaagctgtggttctcaaaggggcaaatgacttagatatcaaagcagagggaaatattaga
ttccggtatatcgttcttcaagacacttgctctaagcggaatggaaatgtgggcaagact
gtctttgaatatagaacacagaatgtggcacgcttgcccatcatagatcttgctcctgtg
gatgttggcggcacagaccaggaattcggcgttgaaattgggccagtttgttttgtgtaa

DBGET integrated database retrieval system