KEGG   Homo sapiens (human): 129401Help
Entry
129401            CDS       T01001                                 

Gene name
NUP35, MP-44, MP44, NP44, NUP53
Definition
(RefSeq) nucleoporin 35
  KO
K14313  
nuclear pore complex protein Nup53
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    129401 (NUP35)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     129401 (NUP35)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8NFH5(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q32.1
AA seq 326 aa AA seqDB search
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctttgcagtggaacctcaggggcccgcgttaggatctgaaccaatgatgctg
ggttcacccacatctccaaagccaggagttaatgcccagttcttacctggatttttaatg
ggggatttgccagctccggtgactccacaacctcgatcaattagtggcccttcagtagga
gtaatggaaatgagatcacctttacttgcaggtgggtcaccaccacaaccagttgtacca
gctcataaagataaaagtggcgctccaccagttagaagtatatatgatgacatttctagc
ccaggacttggatcaacacctttaacttcaagaagacagccaaacatttcagtaatgcag
agtcctcttgttggagttacatctactcctggaacagggcaaagtatgtttagtccagca
agtatcggtcagccacgaaagacgacattatctcctgcccagttggatcctttttatact
caaggagattctttgacttcagaagatcacctcgatgactcttgggtgactgtatttggg
tttcctcaagcatctgcttcctacatattactacaatttgcacagtatgggaatatctta
aaacatgtgatgtctaatacaggaaattggatgcatattcgttatcaatctaaactgcag
gctcggaaagccttaagcaaagatgggaggatttttggagaatccatcatgattggtgta
aaaccatgtattgacaaaagtgttatggaaagcagtgacagatgtgctttatcatctcca
tctttagcctttacaccaccaatcaaaactctaggtacaccaacacaacctggaagtact
cctaggatttctaccatgagacctcttgctacagcatacaaagcctctactagtgattat
caggttatttctgacagacaaacgccaaaaaaagatgaaagtcttgtatccaaagcaatg
gagtacatgtttggctggtag

DBGET integrated database retrieval system