KEGG   Homo sapiens (human): 129642Help
Entry
129642            CDS       T01001                                 

Gene name
MBOAT2, LPAAT, LPCAT4, LPEAT, LPLAT_2, OACT2
Definition
(RefSeq) membrane bound O-acyltransferase domain containing 2
  KO
K13517  lysophospholipid acyltransferase 1/2 [EC:2.3.1.51 2.3.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
Module
hsa_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    129642 (MBOAT2)
   00564 Glycerophospholipid metabolism
    129642 (MBOAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     129642 (MBOAT2)
    2.3.1.-  
     129642 (MBOAT2)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   129642 (MBOAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBOAT
Motif
Other DBs
NCBI-GeneID: 129642
NCBI-ProteinID: NP_620154
OMIM: 611949
HGNC: 25193
Ensembl: ENSG00000143797
Vega: OTTHUMG00000090363
Pharos: Q6ZWT7(Tdark)
UniProt: Q6ZWT7
Position
2p25.1
AA seq 520 aa AA seqDB search
MATTSTTGSTLLQPLSNAVQLPIDQVNFVVCQLFALLAAIWFRTYLHSSKTSSFIRHVVA
TLLGLYLALFCFGWYALHFLVQSGISYCIMIIIGVENMHNYCFVFALGYLTVCQVTRVYI
FDYGQYSADFSGPMMIITQKITSLACEIHDGMFRKDEELTSSQRDLAVRRMPSLLEYLSY
NCNFMGILAGPLCSYKDYITFIEGRSYHITQSGENGKEETQYERTEPSPNTAVVQKLLVC
GLSLLFHLTICTTLPVEYNIDEHFQATASWPTKIIYLYISLLAARPKYYFAWTLADAINN
AAGFGFRGYDENGAARWDLISNLRIQQIEMSTSFKMFLDNWNIQTALWLKRVCYERTSFS
PTIQTFILSAIWHGVYPGYYLTFLTGVLMTLAARAMRNNFRHYFIEPSQLKLFYDVITWI
VTQVAISYTVVPFVLLSIKPSLTFYSSWYYCLHILGILVLLLLPVKKTQRRKNTHENIQL
SQSKKFDEGENSLGQNSFSTTNNVCNQNQEIASRHSSLKQ
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccagcaccacgggctccaccctgctgcagcccctcagcaacgccgtgcag
ctgcccatcgaccaggtcaactttgtagtgtgccaactctttgccttgctagcagccatt
tggtttcgaacttatctacattcaagcaaaactagctcttttataagacatgtagttgct
acccttttgggcctttatcttgcacttttttgctttggatggtatgccttacactttctt
gtacaaagtggaatttcctactgtatcatgatcatcataggagtggagaacatgcacaat
tactgctttgtgtttgctctgggatacctcacagtgtgccaagttactcgagtctatatc
tttgactatggacaatattctgctgatttttcaggcccaatgatgatcattactcagaag
atcactagtttggcttgcgaaattcatgatgggatgtttcggaaggatgaagaactgact
tcctcacagagggatttagctgtaaggcgcatgccaagcttactggagtatttgagttac
aactgtaacttcatggggatcctggcaggcccactttgctcttacaaagactacattact
ttcattgaaggcagatcataccatatcacacaatctggtgaaaatggaaaagaagagaca
cagtatgaaagaacagagccatctccaaatactgcggttgttcagaagctcttagtttgt
gggctgtccttgttatttcacttgaccatctgtacaacattacctgtggagtacaacatt
gatgagcattttcaagctacagcttcgtggccaacaaagattatctatctgtatatctct
cttttggctgccagacccaaatactattttgcatggacgctagctgatgccattaataat
gctgcaggctttggtttcagagggtatgacgaaaatggagcagctcgctgggacttaatt
tccaatttgagaattcaacaaatagagatgtcaacaagtttcaagatgtttcttgataat
tggaatattcagacagctctttggctcaaaagggtgtgttatgaacgaacctccttcagt
ccaactatccagacgttcattctctctgccatttggcacggggtatacccaggatattat
ctaacgtttctaacaggggtgttaatgacattagcagcaagagctatgagaaataacttt
agacattatttcattgaaccttcccaactgaaattattttatgatgttataacatggata
gtaactcaagtagcaataagttacacagttgtgccatttgtgcttctttctataaaacca
tcactcacgttttacagctcctggtattattgcctgcacattcttggtatcttagtatta
ttgttgttgccagtgaaaaaaactcaaagaagaaagaatacacatgaaaacattcagctc
tcacaatccaaaaagtttgatgaaggagaaaattctttgggacagaacagtttttctaca
acaaacaatgtttgcaatcagaatcaagaaatagcctcgagacattcatcactaaagcag
tga

DBGET integrated database retrieval system