KEGG   Homo sapiens (human): 129685Help
Entry
129685            CDS       T01001                                 

Gene name
TAF8, 43, II, TAF, TAFII-43, TAFII43, TBN
Definition
TAF8 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 43kDa
Orthology
K14649  
transcription initiation factor TFIID subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    129685 (TAF8)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     129685 (TAF8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.1
AA seq 310 aa AA seqDB search
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGFESAEKASVET
LTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEMGFNVDTLPAYAKRSQRMVIT
APPVTNQPVTPKALTAGQNRPHPPHIPSHFPEFPDPHTYIKTPTYREPVSDYQVLREKAA
SQRRDVERALTRFMAKTGETQSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEET
DSSEQDEQTDTENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKK
PKIRRKKSLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcggcggccacagctggggccggtggctccggaacgagatcgggaagtaaa
cagtccactaaccctgccgataactatcatctggcccggaggagaaccctgcaggtggtt
gtgagctccttgctgacagaggcagggtttgagagtgccgagaaagcatccgtggaaacg
ctgacagagatgctgcagagctacatttcagaaattgggagaagtgccaagtcttactgt
gagcacacagccaggacccagcccacactgtccgatatcgtggtcacacttgttgagatg
ggtttcaatgtggacactctccctgcttatgcaaaacggtctcagaggatggtcatcact
gctcctccggtgaccaatcagccagtgacccccaaggccctcactgcagggcagaaccga
ccccacccgccgcacatccccagccattttcctgagttccctgatccccacacctacatc
aaaactccgacgtaccgtgagcccgtgtcagactaccaggtcctgcgggagaaggctgca
tcccagaggcgcgatgtggagcgggcacttacccgtttcatggccaagacaggcgagact
cagagtcttttcaaagatgacgtcagcacatttccattgattgctgccagacctttcacc
atcccctacctgacagctcttcttccgtctgaactggagatgcaacaaatggaagagaca
gattcctcggagcaggatgaacagacagacacagagaaccttgctcttcatatcagcatg
gaggattctggagccgagaaggagaacacctctgtcctgcagcagaacccctccttgtcg
ggtagccggaatggggaggagaacatcatcgataacccttatctgcggccggtgaagaag
cccaagatccgcaggaagaagtccctctcctga

DBGET integrated database retrieval system