KEGG   Homo sapiens (human): 129807Help
Entry
129807            CDS       T01001                                 

Gene name
NEU4
Definition
(RefSeq) neuraminidase 4 (sialidase) (EC:3.2.1.18)
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    129807 (NEU4)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    129807 (NEU4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     129807 (NEU4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q37.3
AA seq 484 aa AA seqDB search
MGVPRTPSRTVLFERERTGLTYRVPSLLPVPPGPTLLAFVEQRLSPDDSHAHRLVLRRGT
LAGGSVRWGALHVLGTAALAEHRSMNPCPVHDAGTGTVFLFFIAVLGHTPEAVQIATGRN
AARLCCVASRDAGLSWGSARDLTEEAIGGAVQDWATFAVGPGHGVQLPSGRLLVPAYTYR
VDRRECFGKICRTSPHSFAFYSDDHGRTWRCGGLVPNLRSGECQLAAVDGGQAGSFLYCN
ARSPLGSRVQALSTDEGTSFLPAERVASLPETAWGCQGSIVGFPAPAPNRPRDDSWSVGP
GSPLQPPLLGPGVHEPPEEAAVDPRGGQVPGGPFSRLQPRGDGPRQPGPRPGVSGDVGSW
TLALPMPFAAPPQSPTWLLYSHPVGRRARLHMGIRLSQSPLDPRSWTEPWVIYEGPSGYS
DLASIGPAPEGGLVFACLYESGARTSYDEISFCTFSLREVLENVPASPKPPNLGDKPRGC
CWPS
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccctcgtaccccttcacggacagtgctcttcgagcgggagaggacgggcctg
acctaccgcgtgccctcgctgctccccgtgccccccgggcccaccctgctggcctttgtg
gagcagcggctcagccctgacgactcccacgcccaccgcctggtgctgaggaggggcacg
ctggccgggggctccgtgcggtggggtgccctgcacgtgctggggacagcagccctggcg
gagcaccggtccatgaacccctgccctgtgcacgatgctggcacgggcaccgtcttcctc
ttcttcatcgcggtgctgggccacacgcctgaggccgtgcagatcgccacgggaaggaac
gccgcgcgcctctgctgtgtggccagccgtgacgccggcctctcgtggggcagcgcccgg
gacctcaccgaggaggccatcggtggtgccgtgcaggactgggccacattcgctgtgggt
cccggccacggtgtgcagctgccctcaggccgcctgctggtacccgcctacacctaccgc
gtggaccgccgagagtgttttggcaagatctgccggaccagccctcactccttcgccttc
tacagcgatgaccacggccgcacctggcgctgtggaggcctcgtgcccaacctgcgctca
ggcgagtgccagctggcagcggtggacggtgggcaggccggcagcttcctctactgcaat
gcccggagcccactgggcagccgtgtgcaggcgctcagcactgacgagggcacctccttc
ctgcccgcagagcgcgtggcttccctgcccgagactgcctggggctgccagggcagcatc
gtgggcttcccagcccccgcccccaacaggccacgggatgacagttggtcagtgggcccc
gggagtcccctccagcctccactcctcggtcctggagtccacgaacccccagaggaggct
gctgtagacccccgtggaggccaggtgcctggtgggcccttcagccgtctgcagcctcgg
ggggatggccccaggcagcctggccccaggcctggggtcagtggggatgtggggtcctgg
accctggcactccccatgccctttgctgccccgccccagagccccacgtggctgctgtac
tcccacccagtggggcgcagggctcggctacacatgggtatccgcctgagccagtccccg
ctggacccgcgcagctggacagagccctgggtgatctacgagggccccagcggctactcc
gacctggcgtccatcgggccggcccctgaggggggcctggtttttgcctgcctgtacgag
agcggggccaggacctcctatgatgagatttccttttgtacattctccctgcgtgaggtc
ctggagaacgtgcccgccagccccaaaccgcccaaccttggggacaagcctcgggggtgc
tgctggccctcctga

DBGET integrated database retrieval system