KEGG   Homo sapiens (human): 129831Help
Entry
129831            CDS       T01001                                 

Gene name
RBM45, DRB1, RB-1
Definition
(RefSeq) RNA binding motif protein 45
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.2
AA seq 474 aa AA seqDB search
MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDIQDIWVVRDK
HTKESKGIAFVKFARSSQACRAMEEMHGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEEL
TRIFVMIPKSYTEEDLREKFKVYGDIEYCSIIKNKVTGESKGLGYVRYLKPSQAAQAIEN
CDRSFRAILAEPKNKASESSEQDYYSNMRQEALGHEPRVNMFPFEQQSEFSSFDKNDSRG
QEAISKRLSVVSRVPFTEEQLFSIFDIVPGLEYCEVQRDPYSNYGHGVVQYFNVASAIYA
KYKLHGFQYPPGNRIGVSFIDDGSNATDLLRKMATQMVAAQLASMVWNNPSQQQFMQFGG
SSGSQLPQIQTDVVLPSCKKKAPAETPVKERLFIVFNPHPLPLDVLEDIFCRFGNLIEVY
LVSGKNVGYAKYADRISANDAIATLHGKILNGVRLKVMLADSPREESNKRQRTY
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggacgaagctggcagctctgcgagcggcgggggcttccgcccgggcgtggacagcctg
gacgaaccgcccaacagccgcatcttccttgtgatcagcaagtacacacctgagtcggtg
ctgagggagcgcttctcgccttttggcgacatccaggacatctgggtggtgcgggacaag
cacaccaaggagtccaagggcattgctttcgtcaagttcgcccgcagctcacaggcctgc
agggccatggaggagatgcatggccagtgcctcggccccaacgacaccaagcccatcaag
gttttcattgctcagtcccgatcatctggaagtcaccgagatgttgaagatgaagaactt
acaagaatctttgttatgataccaaagtcctacacagaagaagatctgcgggaaaaattt
aaggtgtatggagatatcgagtattgcagcattattaagaataaagtgactggagaaagt
aaaggtttgggctacgtacgatacttaaaaccatcacaagctgcccaagcaatagaaaac
tgtgatcgaagttttagagcaatcttggctgaacctaaaaataaagcatctgaatcctct
gaacaagattattatagtaatatgaggcaagaagctttgggacatgaacctagagtaaat
atgtttccatttgaacaacaatctgaattttcaagttttgacaagaatgatagccgaggc
caggaagcaatctccaaacgcttgtcagttgtatcaagagttcctttcactgaagaacag
cttttcagcatttttgatatagtaccaggattggaatattgtgaagttcaacgagatcct
tattcaaattatggtcatggagtggttcagtattttaatgtagcatcagctatttatgca
aaatacaaattacatggatttcagtaccctcctgggaaccgaataggtgtttccttcatt
gatgatggaagtaatgcaacagatctccttagaaaaatggcaacacagatggtagctgca
cagcttgcatcaatggtgtggaataacccaagtcagcaacaatttatgcaatttggagga
agctctggatcacagttgcctcaaatccagacagatgttgtacttccatcatgcaaaaaa
aaagctcctgctgaaactcctgtgaaagaaagactttttattgtgtttaatcctcatcct
ttacctttagacgtattagaagatatattctgtcgttttggtaacctgatcgaagtttac
cttgtgtcaggaaaaaatgtggggtatgccaagtatgccgatagaataagtgctaatgat
gccattgccactctacatggaaagattctgaatggggtgagacttaaagttatgctggca
gattcgccaagagaagaatctaacaaacggcaaagaacttactga

DBGET integrated database retrieval system