KEGG   Homo sapiens (human): 13Help
Entry
13                CDS       T01001                                 

Gene name
AADAC, CES5A1, DAC
Definition
(RefSeq) arylacetamide deacetylase (EC:3.1.1.3)
  KO
K13616  
arylacetamide deacetylase [EC:3.1.1.3]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     13 (AADAC)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   13 (AADAC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q25.1
AA seq 399 aa AA seqDB search
MGRKSLYLLIVGILIAYYIYTPLPDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMD
SFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSA
ALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNP
ERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLF
LSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNP
NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTG
VQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgggaagaaaatcgctgtaccttctgattgtggggatcctcatagcatattatatttat
acgcctctcccagataacgttgaggagccatggagaatgatgtggataaacgcacatctg
aaaactatacaaaatttggctacatttgtggagctcctgggacttcaccattttatggat
tcctttaaggttgtcgggagctttgatgaagtcccaccaacctcagatgaaaatgtcact
gtgactgagacaaaattcaacaacattcttgttcgggtatatgtgccaaagagaaagtct
gaagcactaagaagggggttgttttacatccatggtggaggctggtgcgtgggaagtgct
gctctaagtggttatgacttgctgtcaagatggacagcagacagacttgatgctgtcgtc
gtatcaaccaactacagattagcacctaagtatcatttcccaattcaatttgaagatgta
tataatgccttaaggtggttcttacgtaaaaaagttcttgcaaaatatggtgtgaaccct
gagagaatcggtatttctggagatagtgcaggagggaatttagctgcagcagtgactcaa
cagctccttgatgacccagatgtcaagatcaaactcaagatccagtctttaatttatcct
gcccttcagcctcttgatgtagatttaccgtcatatcaagaaaattcaaattttctattt
ctatccaaatcactcatggtcagattctggagtgaatattttaccactgatagatcactt
gaaaaagccatgctttccagacaacatgtacctgtggaatcaagtcatctcttcaaattt
gttaattggagttccctgctccctgagaggtttataaaaggacatgtttataacaatcca
aattatggcagttctgagctggctaaaaaatatccagggttcctagatgtgagggcagcc
cctttgttggctgatgacaacaaattacgtggcttacccctgacctatgtcatcacctgt
caatatgatctcttaagagatgatggactcatgtatgtcacccgacttcgcaacactggg
gttcaggtgactcataaccatgttgaggatggattccatggagcattttcatttctggga
cttaaaattagtcacagacttataaatcagtatattgagtggctaaaggaaaatctatag

DBGET integrated database retrieval system