KEGG   Homo sapiens (human): 130075Help
Entry
130075            CDS       T01001                                 

Gene name
OR9A4
Definition
(RefSeq) olfactory receptor family 9 subfamily A member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    130075 (OR9A4)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    130075 (OR9A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx ATP_bind_1
Motif
Other DBs
NCBI-GeneID: 130075
NCBI-ProteinID: NP_001001656
HGNC: 15095
Ensembl: ENSG00000258083
Vega: OTTHUMG00000158370
Pharos: Q8NGU2(Tdark)
UniProt: Q8NGU2 A0A126GVB1
Position
7q34
AA seq 314 aa AA seqDB search
MLMNYSSATEFYLLGFPGSEELHHILFAIFFFFYLVTLMGNTVIIMIVCVDKRLQSPMYF
FLGHLSALEILVTTIIVPVMLWGLLLPGMQTIYLSACVVQLFLYLAVGTTEFALLGAMAV
DRYVAVCNPLRYNIIMNRHTCNFVVLVSWVFGFLFQIWPVYVMFQLTYCKSNVVNNFFCD
RGQLLKLSCNNTLFTEFILFLMAVFVLFGSLIPTIVSNAYIISTILKIPSSSGRRKSFST
CASHFTCVVIGYGSCLFLYVKPKQTQAADYNWVVSLMVSVVTPFLNPFIFTLRNDKVIEA
LRDGVKRCCQLFRN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaattactctagtgccactgaattttatctccttggcttccctggctctgaa
gaactacatcatatcctttttgctatattcttctttttctacttggtgacattaatggga
aacacagtcatcatcatgattgtctgtgtggataaacgtctgcagtcccccatgtatttc
ttcctcggccacctctctgccctggagatcctggtcacaaccataatcgtccccgtgatg
ctttggggattgctgctccctgggatgcagacaatatatttgtctgcctgtgttgtccag
ctcttcttgtaccttgctgtggggacaacagagttcgcattacttggagcaatggctgtg
gaccgttatgtggctgtctgtaaccctctgaggtacaacatcattatgaacagacacacc
tgcaactttgtggttcttgtgtcatgggtgtttgggtttctttttcaaatctggccggtc
tatgtcatgtttcagcttacttactgcaaatcaaatgtggtgaacaattttttttgtgac
cgagggcaattgctcaaactatcctgcaataatactcttttcacggagtttatcctcttc
ttaatggctgtttttgttctctttggttctttgatccctacaattgtctccaacgcctac
atcatctccaccattctcaagatcccgtcatcctctggccggaggaaatccttctccact
tgtgcctcccacttcacctgtgttgtgattggctacggcagctgcttgtttctctacgtg
aaacccaagcaaacgcaggcagctgattacaattgggtagtttccctgatggtttcagta
gtaactcctttcctcaatcctttcatcttcaccctccggaatgataaagtcatagaggcc
cttcgggatggggtgaaacgctgctgtcaactattcaggaattag

DBGET integrated database retrieval system