KEGG   Homo sapiens (human): 1301Help
Entry
1301              CDS       T01001                                 

Gene name
COL11A1, CO11A1, COLL6, STL2
Definition
(RefSeq) collagen type XI alpha 1
  KO
K19721  
collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00519  
Type XI collagenopathies
H00805  
Vitreoretinal degeneration
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1301 (COL11A1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1301 (COL11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p21
AA seq 1806 aa AA seqDB search
MEPWSSRWKTKRWLWDFTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGF
CTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYN
EHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV
DCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYS
PDCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEA
NIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLY
ENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSINGHG
AYGEKGQKGEPAVVEPGMLVEGPPGPAGPAGIMGPPGLQGPTGPPGDPGDRGPPGRPGLP
GADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRP
GPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDR
GFDGLPGLPGDKGHRGERGPQGPPGPPGDDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTP
GAPGQPGMAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKP
GLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEK
GEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVP
GLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKP
GPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKT
GPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKD
GPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQ
GPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSK
GDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQ
GLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSVGSVGGVGEKGEPGEA
GNPGPPGEAGVGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPP
GEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAK
GEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLP
GLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPLGPP
GPPGLPGPQGPKGNKGSTGPAGQKGDSGLPGPPGSPGPPGEVIQPLPILSSKKTRRHTEG
MQADADDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDG
EYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKL
LSYLDVEGNSINMVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDE
EMSYDNNPFIKTLYDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVG
PVCFLG
NT seq 5421 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtggtcctctaggtggaaaacgaaacggtggctctgggatttcaccgtaaca
accctcgcattgaccttcctcttccaagctagagaggtcagaggagctgctccagttgat
gtactaaaagcactagattttcacaattctccagagggaatatcaaaaacaacgggattt
tgcacaaacagaaagaattctaaaggctcagatactgcttacagagtttcaaagcaagca
caactcagtgccccaacaaaacagttatttccaggtggaactttcccagaagacttttca
atactatttacagtaaaaccaaaaaaaggaattcagtctttccttttatctatatataat
gagcatggtattcagcaaattggtgttgaggttgggagatcacctgtttttctgtttgaa
gaccacactggaaaacctgccccagaagactatcccctcttcagaactgttaacatcgct
gacgggaagtggcatcgggtagcaatcagcgtggagaagaaaactgtgacaatgattgtt
gattgtaagaagaaaaccacgaaaccacttgatagaagtgagagagcaattgttgatacc
aatggaatcacggtttttggaacaaggattttggatgaagaagtttttgagggggacatt
cagcagtttttgatcacaggtgatcccaaggcagcatatgactactgtgagcattatagt
ccagactgtgactcttcagcacccaaggctgctcaagctcaggaacctcagatagatgag
tatgcaccagaggatataatcgaatatgactatgagtatggggaagcagagtataaagag
gctgaaagtgtaacagagggacccactgtaactgaggagacaatagcacagacggaggca
aacatcgttgatgattttcaagaatacaactatggaacaatggaaagttaccagacagaa
gctcctaggcatgtttctgggacaaatgagccaaatccagttgaagaaatatttactgaa
gaatatctaacgggagaggattatgattcccagaggaaaaattctgaggatacactatat
gaaaacaaagaaatagacggcagggattctgatcttctggtagatggagatttaggcgaa
tatgatttttatgaatataaagaatatgaagataaaccaacaagcccccctaatgaagaa
tttggtccaggtgtaccagcagaaactgatattacagaaacaagcataaatggccatggt
gcatatggagagaaaggacagaaaggagaaccagcagtggttgagcctggtatgcttgtc
gaaggaccaccaggaccagcaggacctgcaggtattatgggtcctccaggtctacaaggc
cccactggaccccctggtgaccctggcgataggggccccccaggacgtcctggcttacca
ggggctgatggtctacctggtcctcctggtactatgttgatgttaccgttccgttatggt
ggtgatggttccaaaggaccaaccatctctgctcaggaagctcaggctcaagctattctt
cagcaggctcggattgctctgagaggcccacctggcccaatgggtctaactggaagacca
ggtcctgtgggggggcctggttcatctggggccaaaggtgagagtggtgatccaggtcct
cagggccctcgaggcgtccagggtccccctggtccaacgggaaaacctggaaaaaggggt
cgtccaggtgcagatggaggaagaggaatgccaggagaacctggggcaaagggagatcga
gggtttgatggacttccgggtctgccaggtgacaaaggtcacaggggtgaacgaggtcct
caaggtcctccaggtcctcctggtgatgatggaatgaggggagaagatggagaaattgga
ccaagaggtcttccaggtgaagctggcccacgaggtttgctgggtccaaggggaactcca
ggagctccagggcagcctggtatggcaggtgtagatggccccccaggaccaaaagggaac
atgggtccccaaggggagcctgggcctccaggtcaacaagggaatccaggacctcagggt
cttcctggtccacaaggtccaattggtcctcctggtgaaaaaggaccacaaggaaaacca
ggacttgctggacttcctggtgctgatgggcctcctggtcatcctgggaaagaaggccag
tctggagaaaagggggctctgggtccccctggtccacaaggtcctattggatacccgggc
ccccggggagtaaagggagcagatggtgtcagaggtctcaagggatctaaaggtgaaaag
ggtgaagatggttttccaggattcaaaggtgacatgggtctaaaaggtgacagaggagaa
gttggtcaaattggcccaagaggggaagatggccctgaaggacccaaaggtcgagcaggc
ccaactggagacccaggtccttcaggtcaagcaggagaaaagggaaaacttggagttcca
ggattaccaggatatccaggaagacaaggtccaaagggttccactggattccctgggttt
ccaggtgccaatggagagaaaggtgcacggggagtagctggcaaaccaggccctcggggt
cagcgtggtccaacgggtcctcgaggttcaagaggtgcaagaggtcccactgggaaacct
gggccaaagggcacttcaggtggcgatggccctcctggccctccaggtgaaagaggtcct
caaggacctcagggtccagttggattccctggaccaaaaggccctcctggaccacctggg
aaggatgggctgccaggacaccctgggcaacgtggggagactggatttcaaggcaagacc
ggccctcctgggccagggggagtggttggaccacagggaccaaccggtgagactggtcca
ataggggaacgtgggcatcctggccctcctggccctcctggtgagcaaggtcttcctggt
gctgcaggaaaagaaggtgcaaagggtgatccaggtcctcaaggtatctcagggaaagat
ggaccagcaggattacgtggtttcccaggggaaagaggtcttcctggagctcagggtgca
cctggactgaaaggaggggaaggtccccagggcccaccaggtccagttggctcaccagga
gaacgtgggtcagcaggtacagctggcccaattggtttaccagggcgcccgggacctcag
ggtcctcctggtccagctggagagaaaggtgctcctggagaaaaaggtccccaagggcct
gcagggagagatggagttcaaggtcctgttggtctcccagggccagctggtcctgccggc
tcccctggggaagacggagacaagggtgaaattggtgagccgggacaaaaaggcagcaag
ggtgacaagggagaaaatggccctcccggtcccccaggtcttcaaggaccagttggtgcc
cctggaattgctggaggtgatggtgaaccaggtcctagaggacagcaggggatgtttggg
caaaaaggtgatgagggtgccagaggcttccctggacctcctggtccaataggtcttcag
ggtctgccaggcccacctggtgaaaaaggtgaaaatggggatgttggtcccatggggcca
cctggtcctccaggcccaagaggccctcaaggtcccaatggagctgatggaccacaagga
cccccagggtctgttggttcagttggtggtgttggagaaaagggtgaacctggagaagca
gggaacccagggcctcctggggaagcaggtgtaggcggtcccaaaggagaaagaggagag
aaaggggaagctggtccacctggagctgctggacctccaggtgccaaggggccaccaggt
gatgatggccctaagggtaacccgggtcctgttggttttcctggagatcctggtcctcct
ggggaacctggccctgcaggtcaagatggtgttggtggtgacaagggtgaagatggagat
cctggtcaaccgggtcctcctggcccatctggtgaggctggcccaccaggtcctcctgga
aaacgaggtcctcctggagctgcaggtgcagagggaagacaaggtgaaaaaggtgctaag
ggggaagcaggtgcagaaggtcctcctggaaaaaccggcccagtcggtcctcagggacct
gcaggaaagcctggtccagaaggtcttcggggcatccctggtcctgtgggagaacaaggt
ctccctggagctgcaggccaagatggaccacctggtcctatgggacctcctggcttacct
ggtctcaaaggtgaccctggctccaagggtgaaaagggacatcctggtttaattggcctg
attggtcctccaggagaacaaggggaaaaaggtgaccgagggctccctggaactcaagga
tctccaggagcaaaaggggatgggggaattcctggtcctgctggtcccttaggtccacct
ggtcctccaggtttaccaggtcctcaaggcccaaagggtaacaaaggctctactggaccc
gctggccagaaaggtgacagtggtcttccagggcctcctgggtctccaggtccacctggt
gaagtcattcagcctttaccaatcttgtcctccaaaaaaacgagaagacatactgaaggc
atgcaagcagatgcagatgataatattcttgattactcggatggaatggaagaaatattt
ggttccctcaattccctgaaacaagacattgagcatatgaaatttccaatgggtactcag
accaatccagcccgaacttgtaaagacctgcaactcagccatcctgacttcccagatggt
gaatattggattgatcctaaccaaggttgctcaggagattccttcaaagtttactgtaat
ttcacatctggtggtgagacttgcatttatccagacaaaaaatctgagggagtaagaatt
tcatcatggccaaaggagaaaccaggaagttggtttagtgaatttaagaggggaaaactg
ctttcatacttagatgttgaaggaaattccatcaatatggtgcaaatgacattcctgaaa
cttctgactgcctctgctcggcaaaatttcacctaccactgtcatcagtcagcagcctgg
tatgatgtgtcatcaggaagttatgacaaagcacttcgcttcctgggatcaaatgatgag
gagatgtcctatgacaataatccttttatcaaaacactgtatgatggttgtgcgtccaga
aaaggctatgaaaagactgtcattgaaatcaatacaccaaaaattgatcaagtacctatt
gttgatgtcatgatcaatgactttggtgatcagaatcagaagttcggatttgaagttggt
cctgtttgttttcttggctaa

DBGET integrated database retrieval system