KEGG   Homo sapiens (human): 1302Help
Entry
1302              CDS       T01001                                 

Gene name
COL11A2, DFNA13, DFNB53, FBCG2, HKE5, PARP, STL3
Definition
(RefSeq) collagen type XI alpha 2
  KO
K19721  
collagen, type V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
Protein digestion and absorption
Disease
H00431  
Ossification of the posterior longitudinal ligament of spine (OPLL)
H00519  
Type XI collagenopathies
H00604  
Deafness, autosomal dominant
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04974 Protein digestion and absorption
    1302 (COL11A2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
   1302 (COL11A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 1736 aa AA seqDB search
MERCSRCHRLLLLLPLVLGLSAAPGWAGAPPVDVLRALRFPSLPDGVRRAKGICPADVAY
RVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPV
RFLYEDQTGRPQPPSQPVFRGLSLADGKWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSAR
PVLDTHGVIIFGARILDEEVFEGDVQELAIVPGVQAAYESCEQKELECEGGQRERPQNQQ
PHRAQRSPQQQPSRLHRPQNQEPQSQPTESLYYDYEPPYYDVMTTGTTPDYQDPTPGEEE
EILESSLLPPLEEEQTDLQVPPTADRFQAEEYGEGGTDPPEGPYDYTYGYGDDYREETEL
GPALSAETAHSGAAAHGPRGLKGEKGEPAVLEPGMLVEGPPGPEGPAGLIGPPGIQGNPG
PVGDPGERGPPGRAGLPGSDGAPGPPGTSLMLPFRFGSGGGDKGPVVAAQEAQAQAILQQ
ARLALRGPPGPMGYTGRPGPLGQPGSPGLKGESGDLGPQGPRGPQGLTGPPGKAGRRGRA
GADGARGMPGDPGVKGDRGFDGLPGLPGEKGHRGDTGAQGLPGPPGEDGERGDDGEIGPR
GLPGESGPRGLLGPKGPPGIPGPPGVRGMDGPQGPKGSLGPQGEPGPPGQQGTPGTQGLP
GPQGAIGPHGEKGPQGKPGLPGMPGSDGPPGHPGKEGPPGTKGNQGPSGPQGPLGYPGPR
GVKGVDGIRGLKGHKGEKGEDGFPGFKGDIGVKGDRGEVGVPGSRGEDGPEGPKGRTGPT
GDPGPPGLMGEKGKLGVPGLPGYPGRQGPKGSLGFPGFPGASGEKGARGLSGKSGPRGER
GPTGPRGQRGPRGATGKSGAKGTSGGDGPHGPPGERGLPGPQGPNGFPGPKGPPGPPGKD
GLPGHPGQRGEVGFQGKTGPPGPPGVVGPQGAAGETGPMGERGHPGPPGPPGEQGLPGTA
GKEGTKGDPGPPGAPGKDGPAGLRGFPGERGLPGTAGGPGLKGNEGPSGPPGPAGSPGER
GAAGSGGPIGPPGRPGPQGPPGAAGEKGVPGEKGPIGPTGRDGVQGPVGLPGPAGPPGVA
GEDGDKGEVGDPGQKGTKGNKGEHGPPGPPGPIGPVGQPGAAGADGEPGARGPQGHFGAK
GDEGTRGFNGPPGPIGLQGLPGPSGEKGETGDVGPMGPPGPPGPRGPAGPNGADGPQGPP
GGVGNLGPPGEKGEPGESGSPGIQGEPGVKGPRGERGEKGESGQPGEPGPPGPKGPTGDD
GPKGNPGPVGFPGDPGPPGEGGPRGQDGAKGDRGEDGEPGQPGSPGPTGENGPPGPLGKR
GPAGSPGSEGRQGGKGAKGDPGAIGAPGKTGPVGPAGPAGKPGPDGLRGLPGSVGQQGRP
GATGQAGPPGPVGPPGLPGLRGDAGAKGEKGHPGLIGLIGPPGEQGEKGDRGLPGPQGSP
GQKGEMGIPGASGPIGPGGPPGLPGPAGPKGAKGATGPGGPKGEKGVQGPPGHPGPPGEV
IQPLPIQMPKKTRRSVDGSRLMQEDEAIPTGGAPGSPGGLEEIFGSLDSLREEIEQMRRP
TGTQDSPARTCQDLKLCHPELPDGEYWVDPNQGCARDAFRVFCNFTAGGETCVTPRDDVT
QFSYVDSEGSPVGVVQLTFLRLLSVSAHQDVSYPCSGAARDGPLRLRGANEDELSPETSP
YVKEFRDGCQTQQGRTVLEVRTPVLEQLPVLDASFSDLGAPPRRGGVLLGPVCFMG
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtgcagccgctgccatcgcctcctcctcctcctacctctggtgctggggctg
agcgcggccccaggctgggcaggtgcaccccctgtggatgtgctccgggccctgaggttc
ccctccctccctgatggtgtccggagagcgaaaggcatctgtccagctgatgtggcctac
cgagtggcacgacctgcccagctcagtgcacccactcgccagcttttcccaggaggattt
cccaaagatttctctctgctgactgttgtccggacccgccctggtctccaagctcccctc
ctgactctctacagtgcccagggtgtccgacagctgggcctggagctgggccgacctgtc
cgcttcctgtatgaagaccagactgggcggcctcaacctccctctcagccagtcttccga
ggcctcagcctagcagatggcaagtggcaccgtgtggctgtggctgtgaagggccagtct
gtcaccctcattgttgactgcaagaagcgagtcacccggcctctcccccgaagtgctcgt
ccagtattggacacccatggagtgatcatctttggtgcccgtattctggatgaagaagtc
tttgagggtgatgtccaggagctggccattgtcccaggggtccaggcagcctatgaatca
tgtgaacagaaggagctggaatgcgaggggggccagagggaaagaccccaaaaccaacag
cctcacagagcccagagatctccacagcagcaaccatcaagacttcacaggccacaaaat
caggaaccccagagccagcccactgagtctctctactatgactacgagcccccctattat
gatgtgatgactacggggacaacccctgattatcaggaccccaccccaggtgaagaggaa
gaaatcctggagtcgagcctcttgccaccccttgaggaggagcagacagatctccaggtc
ccccccacagccgacaggttccaggcagaggaatatggggagggtggcacagacccccct
gaagggccctacgattacacctatggctatggggatgattatcgtgaggagacagagctt
ggccctgccctctctgcggagacagcccactcaggagccgctgcccatggaccccgaggg
ctgaagggagagaaaggagagcctgcagtgttggaacctggtatgctcgtggaggggccc
cctggcccagaaggccctgcgggattgattggtccccctggcatccaggggaacccaggc
ccagttggagaccctggagagaggggcccccctggccgagcagggctccctggatcagat
ggggctcctggtcctcctggcacatctctcatgctcccattccggtttggcagtggtggg
ggtgacaagggccctgtggtggcggcccaggaggctcaggcccaggcgatcctgcagcag
gcgaggctggcgctccgtggaccccctggccccatgggatacacagggcgccctggaccc
ttgggccaacctgggagccctggcctgaaaggagagtctggagacttaggacctcagggc
cccagaggacctcagggcctcacaggccctcctggcaaggctgggcgaaggggccgggca
ggtgctgatggagcccgagggatgcctggagatcctggagtgaagggtgaccgaggtttt
gatggactcccagggctccctggagagaagggccataggggtgatactggtgcccagggc
cttcctggtccccctggtgaggatggagagaggggagatgacggggagattgggcctcga
gggctgcctggagagtcgggacctcgaggtctccttggccccaaaggcccacctggtatt
cctggaccccctggcgtccgaggcatggatggtccccagggccccaaagggagcttggga
ccccagggagagccaggacctcctggacaacagggcacccctgggacccagggtcttccc
gggccccagggtgccatcggccctcatggagagaagggtcctcaagggaagccagggctc
cccggcatgcctggctcagacggacccccgggtcacccagggaaggaaggtccccctgga
accaaaggaaaccagggtccctctggacctcagggacctctaggatacccaggacctcga
ggggtcaagggtgtggacggaattcggggtctgaagggtcataagggtgagaagggtgag
gatggctttcctgggttcaaaggtgacataggcgtgaaaggtgacaggggcgaagttgga
gtccctggttccaggggagaggatggtcctgaggggccaaagggacgcactggaccgact
ggagaccctgggcccccagggctcatgggcgagaagggcaagctgggtgttcctggtctg
cctggctatcctggacgtcagggacccaaggggtccctaggatttcctggctttcctggt
gccagtggagagaagggagcccggggcctgtcggggaagtcagggcctcggggagaacgg
ggccccacgggtccacggggtcagcggggaccccgaggtgccactgggaagtctggagct
aagggaacatctggtggtgatggcccccatgggccccctggagagaggggcctccctgga
cctcagggtcccaacgggtttcctggaccgaaaggacccccgggcccccctgggaaggat
gggctgccgggacacccaggccaaagaggagaagtgggtttccaagggaagaccggcccc
cctggtcctccaggagtggtgggacctcagggagcagcaggagaaaccggccctatgggg
gagagaggtcacccaggccccccggggccccctggagagcagggactacctgggacagct
ggaaaagaaggaacaaagggtgaccctggtccccctggggccccagggaaggatggtcct
gctggtctgaggggattcccaggagagagaggcctcccaggcactgctggtggacctggt
ttgaaggggaatgaaggtccgtctggcccccctggccctgcaggctcccctggggaacga
ggtgcagcaggatcagggggacccattggtccgccagggcgcccaggcccgcagggtccc
cctggagcagcaggagagaaaggtgtcccaggtgagaagggccccattggcccgactggc
cgagatggagtgcagggtcctgtggggcttcctggtcctgctgggcctccaggtgtggct
ggagaggatggagacaagggtgaggtgggggaccccggacagaagggcaccaaagggaac
aagggtgaacatggccctcctggaccccctggacccattggtcctgtggggcagcctgga
gcagcgggagcagatggggagcccggagctcggggaccccagggacactttggagccaaa
ggtgatgaaggaacaagaggattcaatgggcccccaggacccattggcctacagggtttg
ccaggcccctctggggagaagggagaaacaggagatgtgggtcctatgggaccacctggc
cccccaggacctcgaggtccagctggacccaatggcgctgatggcccacaaggtccccca
ggaggtgttgggaacctgggtccccctggagagaagggggaaccaggagagtcaggatct
ccagggatccagggcgagccaggtgtcaagggtccacgcggggaacgtggagagaaagga
gagtcggggcagccaggagagccagggccaccagggcctaaaggccccacaggcgatgat
ggccccaaagggaaccctggtcctgttggttttcctggtgaccctggcccccctggagaa
ggtggccctcggggccaggatggtgctaagggtgaccgaggcgaggatggtgagccagga
cagcctggatcccctggtcccaccggggagaatggacccccagggccacttggaaagcga
ggtcctgctggctcgcctggttccgaggggcgacaaggagggaagggagccaagggagat
cctggcgctataggtgccccggggaagacaggcccggtgggtcctgcaggcccagcaggg
aaacctggccctgatggtctgagggggctcccaggctcagtgggtcagcaaggccgacct
ggagctacaggccaggctgggcccccaggtcctgtgggacccccagggctgcctggtctc
cggggcgatgctggagccaagggagagaagggccacccaggtctcattggactgattggg
cccccgggtgagcagggagagaagggagatcggggacttcctgggcctcagggctcccct
gggcagaagggtgagatgggtatcccaggagcatccggccccattggtcctggaggtccc
cccggcctccccggacctgctggccccaaaggagccaaaggagccacaggcccaggcgga
cccaagggagagaagggtgtgcagggccctccaggacacccgggtcccccaggcgaggtg
atccagccactgcccattcagatgcccaagaagactcggcgctcggtggatggaagccgt
ctgatgcaggaagatgaggccataccgaccgggggagcccccggcagtcctggggggctg
gaggagatctttggctcactcgactccctgcgggaggagatcgagcagatgaggcggcca
acagggacccaggacagccctgctcgcacctgccaggacctgaagctgtgccacccagag
cttcccgatggagagtactgggtcgaccccaaccagggctgtgctcgggatgccttccga
gttttctgcaacttcacagcagggggtgagacctgtgtgacgcctagggatgacgtcacg
cagttctcttacgtggactcagagggctccccagtgggtgtggtccagctcaccttcctg
cggctgctcagcgtctcagcccaccaggacgtctcctacccctgctctggagcagcccgt
gacggtcccctgagactccgtggggccaatgaggatgagctgagcccggagactagcccc
tatgtcaaagaattcagagatggctgccagacacagcaaggccggacggtgctggaggtg
cgaacgcctgtgctggagcagctgccagtgctggatgcctccttctcagacctgggagcc
ccaccgaggcggggaggggtgctgctggggcctgtctgcttcatgggatag

DBGET integrated database retrieval system