KEGG   Homo sapiens (human): 130340Help
Entry
130340            CDS       T01001                                 

Gene name
AP1S3
Definition
adaptor-related protein complex 1, sigma 3 subunit
Orthology
K12395  
AP-1 complex subunit sigma-3
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    130340 (AP1S3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q36.1
AA seq 154 aa AA seqDB search
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKIAVKAIEDSDMLQETMEEYMNKPTF
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgatacatttcatattgctcttcagtcgacaagggaaattacggctacagaaatggtac
atcactctccctgataaagagaggaagaagatcacccgggaaattgttcagattattctc
tcccgtggtcacaggacaagcagttttgttgactggaaggagctaaaacttgtttataaa
aggtatgctagtttatatttttgctgtgcaatagaaaatcaggacaatgagctcttgacg
ctagagattgtgcatcgttacgtggagctgctggacaaatattttggaaatgtctgtgag
ctggatattatctttaattttgaaaaggcttatttcatcctggacgagtttataataggt
ggggaaattcaggaaacatccaagaaaattgctgtcaaagccattgaagactctgatatg
ttacaggagacaatggaagaatacatgaacaagcctacattttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system