KEGG   Homo sapiens (human): 130367Help
Entry
130367            CDS       T01001                                 

Gene name
SGPP2, SPP2
Definition
sphingosine-1-phosphate phosphatase 2
Orthology
K04717  
sphingosine-1-phosphate phosphotase 2 [EC:3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    130367 (SGPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     130367 (SGPP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q36.1
AA seq 399 aa AA seqDB search
MAELLRSLQDSQLVARFQRRCGLFPAPDEGPRENGADPTERAARVPGVEHLPAANGKGGE
APANGLRRAAAPEAYVQKYVVKNYFYYYLFQFSAALGQEVFYITFLPFTHWNIDPYLSRR
LIIIWVLVMYIGQVAKDVLKWPRPSSPPVVKLEKRLIAEYGMPSTHAMAATAIAFTLLIS
TMDRYQYPFVLGLVMAVVFSTLVCLSRLYTGMHTVLDVLGGVLITALLIVLTYPAWTFID
CLDSASPLFPVCVIVVPFFLCYNYPVSDYYSPTRADTTTILAAGAGVTIGFWINHFFQLV
SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVLYSWFKVVTRN
KEARRRLEIEVPYKFVTYTSVGICATTFVPMLHRFLGLP
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggccgagctgctgcggagcctgcaggattcccagctcgtcgcccgcttccagcgccgc
tgcgggctcttccccgctccggatgaaggcccccgggagaacggcgcggaccccacggag
cgcgcggcgcgggtccccggggtcgagcatctccccgcagccaacggcaagggcggcgag
gctccggccaacgggctgcgcagagccgcggcgccggaggcttatgtacagaagtacgtc
gtgaagaattatttctactattacctattccaattttcagctgctttgggccaagaagtg
ttctacatcacgtttcttccattcactcactggaatattgacccttatttatccagaaga
ttgatcatcatatgggttttggtgatgtatattggccaagtggccaaggatgtcttgaag
tggccccgtccctcctcccctccagttgtaaaactggaaaagagactgatcgctgaatat
ggaatgccatccacccacgccatggcggccactgccattgccttcaccctccttatctct
actatggacagataccagtatccatttgtgttgggactggtgatggccgtggtgttttcc
accttggtgtgtctcagcaggctctacactgggatgcatacggtcctggatgtgctgggt
ggcgtcctgatcaccgcactcctcatcgtcctcacctaccctgcctggaccttcatcgac
tgcctggactcggccagccccctcttccccgtgtgtgtcatagttgtgccattcttcctg
tgttacaattaccctgtttctgattactacagcccaacccgggcggacaccaccaccatt
ctggctgccggggctggagtgaccataggattctggatcaaccatttcttccagcttgta
tccaagcccgctgaatctctccctgttattcagaacatcccaccactcaccacctacatg
ttagttttgggtctgaccaaatttgcagtgggaattgtgttgatcctcttggttcgtcag
cttgtacaaaatctctcactgcaagtattatactcatggttcaaggtggtcaccaggaac
aaggaggccaggcggagactggagattgaagtgccttacaagtttgttacctacacatct
gttggcatctgcgctacaacctttgtgccgatgcttcacaggtttctgggattaccctga

DBGET integrated database retrieval system