KEGG   Homo sapiens (human): 130872Help
Entry
130872            CDS       T01001                                 

Gene name
AHSA2, Hch1
Definition
(RefSeq) AHA1, activator of heat shock 90kDa protein ATPase homolog 2 (yeast)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p15
AA seq 137 aa AA seqDB search
MILPTKAMATQELTVKRKLSGNTLQVQASSPVALGVRIPTVALHMMELFDTTVEQLYSIF
TVKELTNKKIIMKWRCGNWPEEHYAMVALNFVPTLGQTELQLKEFLSICKEENMKFCWQK
QHFEEIKGSLQLTPLNG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgattttaccaacgaaagctatggcaacccaggaattgactgtcaaaagaaaactgagt
gggaataccctgcaggttcaggcctcatctccagtggcactgggtgtaaggattcccact
gtggctcttcacatgatggaactgtttgacacaactgtagagcagctgtatagcatcttc
actgtaaaggagttaacaaataagaagatcatcatgaaatggagatgtgggaactggcca
gaagaacactatgccatggttgcactgaattttgtgcctactctagggcaaacagaatta
caattgaaggagttcctatctatctgtaaagaagagaacatgaaattctgttggcagaag
cagcattttgaagaaataaaaggttcactgcagctgacccccctaaatggttga

DBGET integrated database retrieval system