KEGG   Homo sapiens (human): 131Help
Entry
131               CDS       T01001                                 

Gene name
ADH7, ADH4
Definition
alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide (EC:1.1.1.1)
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Drug target
Fomepizole: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    131 (ADH7)
  Lipid metabolism
   00071 Fatty acid degradation
    131 (ADH7)
  Amino acid metabolism
   00350 Tyrosine metabolism
    131 (ADH7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    131 (ADH7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    131 (ADH7)
   00982 Drug metabolism - cytochrome P450
    131 (ADH7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    131 (ADH7)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     131 (ADH7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q23-q24
AA seq 386 aa AA seqDB search
MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICR
TDDHVIKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPD
GNLCIRSDITGRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEK
VCLIGCGFSTGYGAAVKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDK
FEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGT
SVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITH
VLPFKKISEGFELLNSGQSIRTVLTF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagaaatacagatccaagacaaagacaggatgggcactgctggaaaagttatt
aaatgcaaagcagctgtgctttgggagcagaagcaacccttctccattgaggaaatagaa
gttgccccaccaaagactaaagaagttcgcattaagattttggccacaggaatctgtcgc
acagatgaccatgtgataaaaggaacaatggtgtccaagtttccagtgattgtgggacat
gaggcaactgggattgtagagagcattggagaaggagtgactacagtgaaaccaggtgac
aaagtcatccctctctttctgccacaatgtagagaatgcaatgcttgtcgcaacccagat
ggcaacctttgcattaggagcgatattactggtcgtggagtactggctgatggcaccacc
agatttacatgcaagggcaaaccagtccaccacttcatgaacaccagtacatttaccgag
tacacagtggtggatgaatcttctgttgctaagattgatgatgcagctcctcctgagaaa
gtctgtttaattggctgtgggttttccactggatatggcgctgctgttaaaactggcaag
gtcaaacctggttccacttgcgtcgtctttggcctgggaggagttggcctgtcagtcatc
atgggctgtaagtcagctggtgcatctaggatcattgggattgacctcaacaaagacaaa
tttgagaaggccatggctgtaggtgccactgagtgtatcagtcccaaggactctaccaaa
cccatcagtgaggtgctgtcagaaatgacaggcaacaacgtgggatacacctttgaagtt
attgggcatcttgaaaccatgattgatgccctggcatcctgccacatgaactatgggacc
agcgtggttgtaggagttcctccatcagccaagatgctcacctatgacccgatgttgctc
ttcactggacgcacatggaagggatgtgtctttggaggtttgaaaagcagagatgatgtc
ccaaaactagtgactgagttcctggcaaagaaatttgacctggaccagttgataactcat
gttttaccatttaaaaaaatcagtgaaggatttgagctgctcaattcaggacaaagcatt
cgaacggtcctgacgttttga

DBGET integrated database retrieval system