KEGG   Homo sapiens (human): 131096Help
Entry
131096            CDS       T01001                                 

Gene name
KCNH8, ELK, ELK1, Kv12.1, elk3
Definition
(RefSeq) potassium voltage-gated channel subfamily H member 8
  KO
K04911  
potassium voltage-gated channel Eag-related subfamily H member 8
Organism
hsa  Homo sapiens (human)
Brite
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   131096 (KCNH8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p24.3
AA seq 1107 aa AA seqDB search
MPVMKGLLAPQNTFLDTIATRFDGTHSNFILANAQVAKGFPIVYCSDGFCELAGFARTEV
MQKSCSCKFLFGVETNEQLMLQIEKSLEEKTEFKGEIMFYKKNGSPFWCLLDIVPIKNEK
GDVVLFLASFKDITDTKVKITPEDKKEDKVKGRSRAGTHFDSARRRSRAVLYHISGHLQR
REKNKLKINNNVFVDKPAFPEYKVSDAKKSKFILLHFSTFKAGWDWLILLATFYVAVTVP
YNVCFIGNDDLSTTRSTTVSDIAVEILFIIDIILNFRTTYVSKSGQVIFEARSICIHYVT
TWFIIDLIAALPFDLLYAFNVTVVSLVHLLKTVRLLRLLRLLQKLDRYSQHSTIVLTLLM
SMFALLAHWMACIWYVIGKMEREDNSLLKWEVGWLHELGKRLESPYYGNNTLGGPSIRSA
YIAALYFTLSSLTSVGFGNVSANTDAEKIFSICTMLIGALMHALVFGNVTAIIQRMYSRW
SLYHTRTKDLKDFIRVHHLPQQLKQRMLEYFQTTWSVNNGIDSNELLKDFPDELRSDITM
HLNKEILQLSLFECASRGCLRSLSLHIKTSFCAPGEYLLRQGDALQAIYFVCSGSMEVLK
DSMVLAILGKGDLIGANLSIKDQVIKTNADVKALTYCDLQCIILKGLFEVLDLYPEYAHK
FVEDIQHDLTYNLREGHESDVISRLSNKSMVSQSEPKGNGNINKRLPSIVEDEEEEEEGE
EEEAVSLSPICTRGSSSRNKKVGSNKAYLGLSLKQLASGTVPFHSPIRVSRSNSPKTKQE
IDPPNHNKRKEKNLKLQLSTLNNAGPPDLSPRIVDGIEDGNSSEESQTFDFGSERIRSEP
RISPPLGDPEIGAAVLFIKAEETKQQINKLNSEVTTLTQEVSQLGKDMRNVIQLLENVLS
PQQPSRFCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWS
VDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHLQFLRCISPHSDSTL
TPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASA
STKPLENLPLEVVTSTAEVKDNKAINV
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
atgccggttatgaaaggattactggcgccgcaaaacaccttcctggacaccatcgccacc
cgttttgacggaacacatagcaacttcatccttgccaatgcccaggtggctaagggtttc
cccatagtctactgttccgatggcttctgcgagcttgctggatttgcccgaactgaagtc
atgcagaagagttgtagctgcaagttcttatttggggttgaaaccaatgagcaactgatg
cttcaaatagaaaagtcactggaggagaaaacagaattcaaaggagaaattatgttctac
aagaaaaacgggtctccattttggtgcctactggatattgttcccataaagaatgaaaaa
ggagatgtagtactttttctggcctcgttcaaagatataacagatacaaaagtgaagatt
actccagaagataaaaaagaagacaaagtcaaaggaagatcaagagcagggacccacttt
gactcagcccggagacggagtcgagcagtcctttatcacatctctgggcacctgcaaaga
agagaaaagaacaaattgaaaataaataacaatgtttttgtagataaaccagcatttccg
gagtataaagtttctgatgcaaaaaagtccaaattcatacttctgcattttagcactttt
aaagctggctgggactggcttattttgttggcaacgttttatgttgctgtgactgtacct
tacaacgtttgctttattggcaatgacgacctgtccacaactcggagcacaaccgtcagt
gacattgcagtggagattctttttattatagatattattttaaatttccgaacaacttat
gtcagcaagtctggccaagttatctttgaagcaagatcaatttgcatccactatgtcaca
acctggttcatcattgatttaatcgctgccctgccttttgatcttctgtatgctttcaac
gtcacagtggtgtctctcgtgcatcttctaaagacagtgcgcctcttgcgtcttttgcgt
ctgctgcagaagttagaccgctattcccaacacagtactatcgtcctgactctgctcatg
tccatgtttgcactccttgcacactggatggcgtgtatctggtacgtcattggaaaaatg
gagagggaagacaacagccttctgaagtgggaagttggttggcttcatgagttgggaaag
agactggaatctccatactatggcaacaataccttggggggcccgtcgatccgaagtgcc
tatattgccgctctgtacttcacgctgagcagcctcaccagcgtgggttttgggaacgtc
tctgctaatacagatgcagaaaagatcttctccatctgcaccatgctgattggtgccttg
atgcacgccttggtgtttggaaacgtgacagcaatcatacagaggatgtactccagatgg
tccctctatcacactagaactaaggatctgaaagatttcatccgtgtccatcacttgccc
caacaactcaagcagaggatgctcgaatattttcaaacaacctggtcagtcaacaatgga
atagattcaaatgagcttttgaaagactttccagatgaactgcgttctgacatcactatg
cacttgaacaaggagatcttacagttgtccctttttgaatgtgccagccggggctgcctc
aggtctctgtctctacacatcaaaacctctttctgtgctccgggggagtatctgctgcgt
caaggggatgctttgcaggccatctactttgtatgctcgggctccatggaagttcttaaa
gacagcatggtgctggctattcttgggaaaggggatttaattggagcaaatctatcaatt
aaggaccaagtgatcaagaccaatgcagatgtaaaggctttaacctactgtgatctccag
tgtatcatcctcaaaggactctttgaagtgctagacctttacccagaatatgctcacaaa
ttcgtggaagacattcagcatgacctcacatacaacctccgagaaggtcatgagagtgat
gtgatatcaagactatcaaacaaatctatggtctcacagtcagagcccaagggaaatggc
aacatcaacaagcgactcccatccattgtggaagatgaggaagaggaggaggagggggag
gaagaggaggcagtctccctctctcccatctgcacaaggggatcttcttcgcgcaacaag
aaggttggaagcaataaagcctacctgggcttaagcttaaagcaactggcctcgggaacg
gtgccctttcactcgcctatcagagtctccaggtcaaattcccccaaaaccaagcaggaa
attgacccccccaaccataataaaaggaaagagaagaacttgaaattgcaactttcaact
ttgaataatgctggacccccagacctcagtccaaggattgttgatggaattgaagatgga
aacagcagtgaagaaagtcagacttttgattttggctctgaacgaatcagatcagagccc
agaatttctcctcctcttggagatccagagattggagctgctgttctcttcatcaaagca
gaggagaccaagcagcagataaacaaactcaacagtgaggtaacaacattgactcaggaa
gtttctcagttgggtaaagacatgagaaatgtgatccagcttctggaaaacgttctgtca
cctcagcagccatcacggttttgctctttgcacagcacctctgtgtgtccctccagggag
agcttacagaccagaacgagctggagtgcacaccagccttgcctacacttgcaaacaggc
ggggctgcttatacccaagcacaactttgtagcagtaatatcacctcagacatttggagt
gtggatccctcctctgtggggagcagcccccaacgaactggagctcatgagcaaaatcct
gcagacagtgaactttatcattctccaagccttgattattcaccttcccactaccaggtt
gtccaagaaggtcatttgcaatttttaaggtgcatctctccacattcagattctacgttg
acgcctctgcagtccatttcagcaactctctcatcttctgtctgctcctcttcggaaaca
tctttgcacctagttctcccaagcagatcagaggagggcagcttcagtcagggaactgtg
agttccttcagtctggaaaacttaccaggatcttggaaccaggaaggaatggcatcagct
tctacaaaacctttggagaaccttccactggaagttgtcacaagcacagcagaagtgaaa
gataacaaagccataaatgtatga

DBGET integrated database retrieval system