KEGG   Homo sapiens (human): 1311Help
Entry
1311              CDS       T01001                                 

Gene name
COMP, EDM1, EPD1, MED, PSACH, THBS5
Definition
cartilage oligomeric matrix protein
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Disease
H00476  
Multiple epiphyseal dysplasia (MED)
H00477  
Pseudoachondroplasia (PSACH)
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:hsa04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.1
AA seq 757 aa AA seqDB search
MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTD
INECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEH
ADCVLERDGSRSCVCAVGWAGNGILCGRDTDLDGFPDEKLRCPERQCRKDNCVTVPNSGQ
EDVDRDGIGDACDPDADGDGVPNEKDNCPLVRNPDQRNTDEDKWGDACDNCRSQKNDDQK
DTDQDGRGDACDDDIDGDRIRNQADNCPRVPNSDQKDSDGDGIGDACDNCPQKSNPDQAD
VDHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQEDSDHDGQGDACDDDDDNDGVPDS
RDNCRLVPNPGQEDADRDGVGDVCQDDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLD
PEGDAQIDPNWVVLNQGREIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFI
FGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDT
ESQVRLLWKDPRNVGWKDKKSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGG
RLGVFCFSQENIIWANLRYRCNDTIPEDYETHQLRQA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggtccccgacaccgcctgcgttcttctgctcaccctggctgccctcggcgcgtccgga
cagggccagagcccgttgggctcagacctgggcccgcagatgcttcgggaactgcaggaa
accaacgcggcgctgcaggacgtgcgggagctgctgcggcagcaggtcagggagatcacg
ttcctgaaaaacacggtgatggagtgtgacgcgtgcgggatgcagcagtcagtacgcacc
ggcctacccagcgtgcggcccctgctccactgcgcgcccggcttctgcttccccggcgtg
gcctgcatccagacggagagcggcgcgcgctgcggcccctgccccgcgggcttcacgggc
aacggctcgcactgcaccgacgtcaacgagtgcaacgcccacccctgcttcccccgagtc
cgctgtatcaacaccagcccggggttccgctgcgaggcttgcccgccggggtacagcggc
cccacccaccagggcgtggggctggctttcgccaaggccaacaagcaggtttgcacggac
atcaacgagtgtgagaccgggcaacataactgcgtccccaactccgtgtgcatcaacacc
cggggctccttccagtgcggcccgtgccagcccggcttcgtgggcgaccaggcgtccggc
tgccagcggcgcgcacagcgcttctgccccgacggctcgcccagcgagtgccacgagcat
gcagactgcgtcctagagcgcgatggctcgcggtcgtgcgtgtgtgccgttggctgggcc
ggcaacgggatcctctgtggtcgcgacactgacctagacggcttcccggacgagaagctg
cgctgcccggagcgccagtgccgtaaggacaactgcgtgactgtgcccaactcagggcag
gaggatgtggaccgcgatggcatcggagacgcctgcgatccggatgccgacggggacggg
gtccccaatgaaaaggacaactgcccgctggtgcggaacccagaccagcgcaacacggac
gaggacaagtggggcgatgcgtgcgacaactgccggtcccagaagaacgacgaccaaaag
gacacagaccaggacggccggggcgatgcgtgcgacgacgacatcgacggcgaccggatc
cgcaaccaggccgacaactgccctagggtacccaactcagaccagaaggacagtgatggc
gatggtataggggatgcctgtgacaactgtccccagaagagcaacccggatcaggcggat
gtggaccacgactttgtgggagatgcttgtgacagcgatcaagaccaggatggagacgga
catcaggactctcgggacaactgtcccacggtgcctaacagtgcccaggaggactcagac
cacgatggccagggtgatgcctgcgacgacgacgacgacaatgacggagtccctgacagt
cgggacaactgccgcctggtgcctaaccccggccaggaggacgcggacagggacggcgtg
ggcgacgtgtgccaggacgactttgatgcagacaaggtggtagacaagatcgacgtgtgt
ccggagaacgctgaagtcacgctcaccgacttcagggccttccagacagtcgtgctggac
ccggagggtgacgcgcagattgaccccaactgggtggtgctcaaccagggaagggagatc
gtgcagacaatgaacagcgacccaggcctggctgtgggttacactgccttcaatggcgtg
gacttcgagggcacgttccatgtgaacacggtcacggatgacgactatgcgggcttcatc
tttggctaccaggacagctccagcttctacgtggtcatgtggaagcagatggagcaaacg
tattggcaggcgaaccccttccgtgctgtggccgagcctggcatccaactcaaggctgtg
aagtcttccacaggccccggggaacagctgcggaacgctctgtggcatacaggagacaca
gagtcccaggtgcggctgctgtggaaggacccgcgaaacgtgggttggaaggacaagaag
tcctatcgttggttcctgcagcaccggccccaagtgggctacatcagggtgcgattctat
gagggccctgagctggtggccgacagcaacgtggtcttggacacaaccatgcggggtggc
cgcctgggggtcttctgcttctcccaggagaacatcatctgggccaacctgcgttaccgc
tgcaatgacaccatcccagaggactatgagacccatcagctgcggcaagcctag

DBGET integrated database retrieval system