KEGG   Homo sapiens (human): 131890Help
Entry
131890            CDS       T01001                                 

Gene name
GRK7, GPRK7
Definition
(RefSeq) G protein-coupled receptor kinase 7 (EC:2.7.11.14 2.7.11.16)
  KO
K00909  
rhodopsin kinase [EC:2.7.11.14]
Organism
hsa  Homo sapiens (human)
Pathway
Chemokine signaling pathway
Endocytosis
Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    131890 (GRK7)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    131890 (GRK7)
  Sensory system
   04744 Phototransduction
    131890 (GRK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.14  rhodopsin kinase
     131890 (GRK7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   131890 (GRK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
3q24
AA seq 553 aa AA seqDB search
MVDMGALDNLIANTAYLQARKPSDCDSKELQRRRRSLALPGLQGCAELRQKLSLNFHSLC
EQQPIGRRLFRDFLATVPTFRKAATFLEDVQNWELAEEGPTKDSALQGLVATCASAPAPG
NPQPFLSQAVATKCQAATTEEERVAAVTLAKAEAMAFLQEQPFKDFVTSAFYDKFLQWKL
FEMQPVSDKYFTEFRVLGKGGFGEVCAVQVKNTGKMYACKKLDKKRLKKKGGEKMALLEK
EILEKVSSPFIVSLAYAFESKTHLCLVMSLMNGGDLKFHIYNVGTRGLDMSRVIFYSAQI
ACGMLHLHELGIVYRDMKPENVLLDDLGNCRLSDLGLAVEMKGGKPITQRAGTNGYMAPE
ILMEKVSYSYPVDWFAMGCSIYEMVAGRTPFKDYKEKVSKEDLKQRTLQDEVKFQHDNFT
EEAKDICRLFLAKKPEQRLGSREKSDDPRKHHFFKTINFPRLEAGLIEPPFVPDPSVVYA
KDIAEIDDFSEVRGVEFDDKDKQFFKNFATGAVPIAWQEEIIETGLFEELNDPNRPTGCE
EGNSSKSGVCLLL
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atggtggacatgggggccctggacaacctgatcgccaacaccgcctacctgcaggcccgg
aagccctcggactgcgacagcaaagagctgcagcggcggcggcgtagcctggccctgccc
gggctgcagggctgcgcggagctccgccagaagctgtccctgaacttccacagcctgtgt
gagcagcagcccatcggtcgccgcctcttccgtgacttcctagccacagtgcccacgttc
cgcaaggcggcaaccttcctagaggacgtgcagaactgggagctggccgaggagggaccc
accaaagacagcgcgctgcaggggctggtggccacttgtgcgagtgcccctgccccgggg
aacccgcaacccttcctcagccaggccgtggccaccaagtgccaagcagccaccactgag
gaagagcgagtggctgcagtgacgctggccaaggctgaggccatggctttcttgcaagag
cagccctttaaggatttcgtgaccagcgccttctacgacaagtttctgcagtggaaactc
ttcgagatgcaaccagtgtcagacaagtacttcactgagttcagagtgctggggaaaggt
ggttttggggaggtatgtgccgtccaggtgaaaaacactgggaagatgtatgcctgtaag
aaactggacaagaagcggctgaagaagaaaggtggcgagaagatggctctcttggaaaag
gaaatcttggagaaggtcagcagccctttcattgtctctctggcctatgcctttgagagc
aagacccatctctgccttgtcatgagcctgatgaatgggggagacctcaagttccacatc
tacaacgtgggcacgcgtggcctggacatgagccgggtgatcttttactcggcccagata
gcctgtgggatgctgcacctccatgaactcggcatcgtctatcgggacatgaagcctgag
aatgtgcttctggatgacctcggcaactgcaggttatctgacctggggctggccgtggag
atgaagggtggcaagcccatcacccagagggctggaaccaatggttacatggctcctgag
atcctaatggaaaaggtaagttattcctatcctgtggactggtttgccatgggatgcagc
atttatgaaatggttgctggacgaacaccattcaaagattacaaggaaaaggtcagtaaa
gaggatctgaagcaaagaactctgcaagacgaggtcaaattccagcatgataacttcaca
gaggaagcaaaagatatttgcaggctcttcttggctaagaaaccagagcaacgcttagga
agcagagaaaagtctgatgatcccaggaaacatcatttctttaaaacgatcaactttcct
cgcctggaagctggcctaattgaacccccatttgtgccagacccttcagtggtttatgcc
aaagacatcgctgaaattgatgatttctctgaggttcggggggtggaatttgatgacaaa
gataagcagttcttcaaaaactttgcgacaggtgctgttcctatagcatggcaggaagaa
attatagaaacgggactgtttgaggaactgaatgaccccaacagacctacgggttgtgag
gagggtaattcatccaagtctggcgtgtgtttgttattgtaa

DBGET integrated database retrieval system