KEGG   Homo sapiens (human): 1326Help
Entry
1326              CDS       T01001                                 

Gene name
MAP3K8, COT, EST, ESTF, MEKK8, TPL2, Tpl-2, c-COT
Definition
mitogen-activated protein kinase kinase kinase 8 (EC:2.7.11.25)
Orthology
K04415  
mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:hsa04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:hsa04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:hsa04660]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p11.23
AA seq 467 aa AA seqDB search
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatgagcactggaagtgacaataaagaagagattgatttattaattaaacat
ttaaatgtgtctgatgtaatagacattatggaaaatctttatgcaagtgaagagccagca
gtttatgaacccagtctaatgaccatgtgtcaagacagtaatcaaaacgatgagcgttct
aagtctctgctgcttagtggccaagaggtaccatggttgtcatcagtcagatatggaact
gtggaggatttgcttgcttttgcaaaccatatatccaacactgcaaagcatttttatgga
caacgaccacaggaatctggaattttattaaacatggtcatcactccccaaaatggacgt
taccaaatagattccgatgttctcctgatcccctggaagctgacttacaggaatattggt
tctgattttattcctcggggcgcctttggaaaggtatacttggcacaagatataaagacg
aagaaaagaatggcgtgtaaactgatcccagtagatcaatttaagccatctgatgtggaa
atccaggcttgcttccggcacgagaacatcgcagagctgtatggcgcagtcctgtggggt
gaaactgtccatctctttatggaagcaggcgagggagggtctgttctggagaaactggag
agctgtggaccaatgagagaatttgaaattatttgggtgacaaagcatgttctcaaggga
cttgattttctacactcaaagaaagtgatccatcatgatattaaacctagcaacattgtt
ttcatgtccacaaaagctgttttggtggattttggcctaagtgttcaaatgaccgaagat
gtctattttcctaaggacctccgaggaacagagatttacatgagcccagaggtcatcctg
tgcaggggccattcaaccaaagcagacatctacagcctgggggccacgctcatccacatg
cagacgggcaccccaccctgggtgaagcgctaccctcgctcagcctatccctcctacctg
tacataatccacaagcaagcacctccactggaagacattgcagatgactgcagtccaggg
atgagagagctgatagaagcttccctggagagaaaccccaatcaccgcccaagagccgca
gacctactaaaacatgaggccctgaacccgcccagagaggatcagccacgctgtcagagt
ctggactctgccctcttggagcgcaagaggctgctgagtaggaaggagctggaacttcct
gagaacattgctgattcttcgtgcacaggaagcaccgaggaatctgagatgctcaagagg
caacgctctctctacatcgacctcggcgctctggctggctacttcaatcttgttcgggga
ccaccaacgcttgaatatggctga

DBGET integrated database retrieval system