KEGG   Homo sapiens (human): 1326Help
Entry
1326              CDS       T01001                                 

Gene name
MAP3K8, COT, EST, ESTF, MEKK8, TPL2, Tpl-2, c-COT
Definition
mitogen-activated protein kinase kinase kinase 8 (EC:2.7.11.25)
Orthology
K04415  
mitogen-activated protein kinase kinase kinase 8 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Toll-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    1326 (MAP3K8)
   04668 TNF signaling pathway
    1326 (MAP3K8)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    1326 (MAP3K8)
   04660 T cell receptor signaling pathway
    1326 (MAP3K8)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     1326 (MAP3K8)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: STE group
  Other families
   1326 (MAP3K8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p11.23
AA seq 467 aa AA seqDB search
MEYMSTGSDNKEEIDLLIKHLNVSDVIDIMENLYASEEPAVYEPSLMTMCQDSNQNDERS
KSLLLSGQEVPWLSSVRYGTVEDLLAFANHISNTAKHFYGQRPQESGILLNMVITPQNGR
YQIDSDVLLIPWKLTYRNIGSDFIPRGAFGKVYLAQDIKTKKRMACKLIPVDQFKPSDVE
IQACFRHENIAELYGAVLWGETVHLFMEAGEGGSVLEKLESCGPMREFEIIWVTKHVLKG
LDFLHSKKVIHHDIKPSNIVFMSTKAVLVDFGLSVQMTEDVYFPKDLRGTEIYMSPEVIL
CRGHSTKADIYSLGATLIHMQTGTPPWVKRYPRSAYPSYLYIIHKQAPPLEDIADDCSPG
MRELIEASLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKELELP
ENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggagtacatgagcactggaagtgacaataaagaagagattgatttattaattaaacat
ttaaatgtgtctgatgtaatagacattatggaaaatctttatgcaagtgaagagccagca
gtttatgaacccagtctaatgaccatgtgtcaagacagtaatcaaaacgatgagcgttct
aagtctctgctgcttagtggccaagaggtaccatggttgtcatcagtcagatatggaact
gtggaggatttgcttgcttttgcaaaccatatatccaacactgcaaagcatttttatgga
caacgaccacaggaatctggaattttattaaacatggtcatcactccccaaaatggacgt
taccaaatagattccgatgttctcctgatcccctggaagctgacttacaggaatattggt
tctgattttattcctcggggcgcctttggaaaggtatacttggcacaagatataaagacg
aagaaaagaatggcgtgtaaactgatcccagtagatcaatttaagccatctgatgtggaa
atccaggcttgcttccggcacgagaacatcgcagagctgtatggcgcagtcctgtggggt
gaaactgtccatctctttatggaagcaggcgagggagggtctgttctggagaaactggag
agctgtggaccaatgagagaatttgaaattatttgggtgacaaagcatgttctcaaggga
cttgattttctacactcaaagaaagtgatccatcatgatattaaacctagcaacattgtt
ttcatgtccacaaaagctgttttggtggattttggcctaagtgttcaaatgaccgaagat
gtctattttcctaaggacctccgaggaacagagatttacatgagcccagaggtcatcctg
tgcaggggccattcaaccaaagcagacatctacagcctgggggccacgctcatccacatg
cagacgggcaccccaccctgggtgaagcgctaccctcgctcagcctatccctcctacctg
tacataatccacaagcaagcacctccactggaagacattgcagatgactgcagtccaggg
atgagagagctgatagaagcttccctggagagaaaccccaatcaccgcccaagagccgca
gacctactaaaacatgaggccctgaacccgcccagagaggatcagccacgctgtcagagt
ctggactctgccctcttggagcgcaagaggctgctgagtaggaaggagctggaacttcct
gagaacattgctgattcttcgtgcacaggaagcaccgaggaatctgagatgctcaagagg
caacgctctctctacatcgacctcggcgctctggctggctacttcaatcttgttcgggga
ccaccaacgcttgaatatggctga

DBGET integrated database retrieval system