KEGG   Homo sapiens (human): 132789Help
Entry
132789            CDS       T01001                                 

Gene name
GNPDA2, GNP2, SB52
Definition
(RefSeq) glucosamine-6-phosphate deaminase 2
  KO
K02564  
glucosamine-6-phosphate deaminase [EC:3.5.99.6]
Organism
hsa  Homo sapiens (human)
Pathway
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    132789 (GNPDA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.6  glucosamine-6-phosphate deaminase
     132789 (GNPDA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q8TDQ7(Tbio)
UniProt: 
Position
4p12
AA seq 276 aa AA seqDB search
MRLVILDNYDLASEWAAKYICNRIIQFKPGQDRYFTLGLPTGSTPLGCYKKLIEYHKNGH
LSFKYVKTFNMDEYVGLPRNHPESYHSYMWNNFFKHIDIDPNNAHILDGNAADLQAECDA
FENKIKEAGGIDLFVGGIGPDGHIAFNEPGSSLVSRTRLKTLAMDTILANAKYFDGDLSK
VPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNHMWTVSAFQQHPRTIFVCD
EDATLELRVKTVKYFKGLMHVHNKLVDPLFSMKDGN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgaggcttgtaattcttgataactatgacttggctagtgaatgggcagccaaatacatc
tgtaatcgcatcattcagttcaaacctggacaggacagatattttacactgggtttacca
acagggagtacacctttaggatgctataaaaaactaatagaatatcataagaatggacac
ctttcttttaaatatgtgaagacctttaatatggatgaatatgtaggacttccaagaaat
catcctgaaagctaccattcttatatgtggaataatttttttaagcatatcgatatagat
cctaataatgcacatatccttgacgggaatgctgcagatttacaagcagaatgtgatgct
tttgaaaacaaaataaaagaagctggaggaatagatctttttgttggaggaattggtcca
gatggtcatatcgctttcaatgagcctggatccagtttagtgtcaaggacaagattaaag
actctagcaatggataccatcttggcaaatgccaaatattttgatggagatttatcaaaa
gtgccaactatggctctaactgttggtgtggggacagtgatggatgctagagaagtaatg
atccttataacaggggcacacaaggcatttgccctgtacaaagcaatagaagaaggagtc
aatcacatgtggactgtttccgctttccagcagcatccccggactatttttgtatgcgat
gaagatgctactttagaattaagagttaaaactgtgaaatactttaaaggtctaatgcat
gtgcacaataaacttgtggatccactattcagtatgaaagatggaaactga

DBGET integrated database retrieval system