KEGG   Homo sapiens (human): 1329Help
Entry
1329              CDS       T01001                                 

Gene name
COX5B, COXVB
Definition
(RefSeq) cytochrome c oxidase subunit 5B (EC:1.9.3.1)
  KO
K02265  
cytochrome c oxidase subunit 5b
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1329 (COX5B)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1329 (COX5B)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1329 (COX5B)
   05012 Parkinson's disease
    1329 (COX5B)
   05016 Huntington's disease
    1329 (COX5B)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1329 (COX5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
2q11.2
AA seq 129 aa AA seqDB search
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagctggaacgctggccgcgcaggccctgagggctcgc
ggccccagtggcgcggccgcgatgcgctccatggcatctggaggtggtgttcccactgat
gaagagcaggcgactgggttggagagggagatcatgctggctgcaaagaagggactggac
ccatacaatgtactggccccaaagggagcttcaggcaccagggaagaccctaatttagtc
ccctccatctccaacaagagaatagtaggctgcatctgtgaagaggacaataccagcgtc
gtctggttttggctgcacaaaggcgaggcccagcgatgcccccgctgtggagcccattac
aagctggtgccccagcagctggcacactga

DBGET integrated database retrieval system