KEGG   Homo sapiens (human): 1329Help
Entry
1329              CDS       T01001                                 

Gene name
COX5B, COXVB
Definition
(RefSeq) cytochrome c oxidase subunit 5B
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1329 (COX5B)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1329 (COX5B)
  Environmental adaptation
   04714 Thermogenesis
    1329 (COX5B)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1329 (COX5B)
   05012 Parkinson's disease
    1329 (COX5B)
   05016 Huntington's disease
    1329 (COX5B)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1329 (COX5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX5B
Motif
Other DBs
NCBI-GeneID: 1329
NCBI-ProteinID: NP_001853
OMIM: 123866
HGNC: 2269
Ensembl: ENSG00000135940
Vega: OTTHUMG00000130548
Pharos: P10606(Tbio)
UniProt: P10606
Position
2q11.2
AA seq 129 aa AA seqDB search
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagctggaacgctggccgcgcaggccctgagggctcgc
ggccccagtggcgcggccgcgatgcgctccatggcatctggaggtggtgttcccactgat
gaagagcaggcgactgggttggagagggagatcatgctggctgcaaagaagggactggac
ccatacaatgtactggccccaaagggagcttcaggcaccagggaagaccctaatttagtc
ccctccatctccaacaagagaatagtaggctgcatctgtgaagaggacaataccagcgtc
gtctggttttggctgcacaaaggcgaggcccagcgatgcccccgctgtggagcccattac
aagctggtgccccagcagctggcacactga

DBGET integrated database retrieval system