KEGG   Homo sapiens (human): 133Help
Entry
133               CDS       T01001                                 

Gene name
ADM, AM, PAMP
Definition
(RefSeq) adrenomedullin
  KO
K12333  
adrenomedullin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    133 (ADM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.4
AA seq 185 aa AA seqDB search
MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
APHFL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggtttccgtcgccctgatgtacctgggttcgctcgccttcctaggcgctgac
accgctcggttggatgtcgcgtcggagtttcgaaagaagtggaataagtgggctctgagt
cgtgggaagagggaactgcggatgtccagcagctaccccaccgggctcgctgacgtgaag
gccgggcctgcccagacccttattcggccccaggacatgaagggtgcctctcgaagcccc
gaagacagcagtccggatgccgcccgcatccgagtcaagcgctaccgccagagcatgaac
aacttccagggcctccggagctttggctgccgcttcgggacgtgcacggtgcagaagctg
gcacaccagatctaccagttcacagataaggacaaggacaacgtcgcccccaggagcaag
atcagcccccagggctacggccgccggcgccggcgctccctgcccgaggccggcccgggt
cggactctggtgtcttctaagccacaagcacacggggctccagcccccccgagtggaagt
gctccccactttctttag

DBGET integrated database retrieval system